DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and acot16

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_001923534.4 Gene:acot16 / 402867 ZFINID:ZDB-GENE-041210-201 Length:460 Species:Danio rerio


Alignment Length:169 Identity:28/169 - (16%)
Similarity:58/169 - (34%) Gaps:63/169 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 HVLPSNAVRRFKRELRVEE---EVAQDPDQQLDPAPGNERELKELSPAIRSEFPVVLPENEQLFY 172
            ||:|            |::   ||.:|..:::...|.||                   :|..:..
Zfish   299 HVVP------------VDKCIFEVLEDMKRRMGKVPVNE-------------------DNHLIHR 332

  Fly   173 ERLLRMP--------GGTV---VLYLHG----NTASRGSGHRSEVYKLLRKL-NYH---VFSFDY 218
            :.:|.:|        .|.:   ::.::|    |.|:..|.  .::..::.|. |.|   ||::..
Zfish   333 DTILPIPSDPALKVDAGRIKCPIMLVNGTDDQNWATVESA--QDIEMIMEKAGNRHLLTVFTYPD 395

  Fly   219 RGYADSDPVPPTEEGVVRDAMMVFEYIANTTSNPIVVWG 257
            .|:....|..|        .......:.:.....:::||
Zfish   396 AGHLIEPPYTP--------HFRATNVLLHKKEKVVMLWG 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 14/86 (16%)
acot16XP_001923534.4 Bile_Hydr_Trans 51..178 CDD:309767
BAAT_C 242..453 CDD:312395 28/169 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.