DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and abhd17c

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_956451.1 Gene:abhd17c / 393126 ZFINID:ZDB-GENE-040426-714 Length:294 Species:Danio rerio


Alignment Length:187 Identity:51/187 - (27%)
Similarity:77/187 - (41%) Gaps:44/187 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 VLYLHGNTASRGSGHRSEVYKLLRKLNYHVFSFDYRGYADSDPVPPTEEGVVRDAMMVFEYIAN- 247
            :|:.|||....|. ..|....|..::|.:|||:||.||..|.. .|:|:.:..|....::.:.| 
Zfish   100 LLFSHGNAVDLGQ-MCSFYIGLGSRINCNVFSYDYSGYGVSTG-KPSEKNLYADIEAAWQVLRNK 162

  Fly   248 --TTSNPIVVWGHSLGTGVATHLCAKLASLRERAPRGVILESP--------FTNIRDEIRMHPFA 302
              .|...|:::|.|:|| |.|   ..|||..|.|  .|||.||        |.:.|.......|.
Zfish   163 YGVTPENIILYGQSIGT-VPT---VDLASRYECA--AVILHSPLMSGLRVAFPDTRKTYCFDAFP 221

  Fly   303 KLYKNLPWFNFTISQPMYTNRLRFESDVHVLEFRQPIMIIHAEDDVVVPFNLGYRLY 359
            .:.|                         |.:...|:::||..:|.|:.|:.|..:|
Zfish   222 SIDK-------------------------VSKVASPVLVIHGTEDEVIDFSHGLAIY 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 51/187 (27%)
abhd17cNP_956451.1 Hydrolase_4 94..270 CDD:288960 51/187 (27%)
Abhydrolase_5 99..271 CDD:289465 51/187 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.