DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and CG1309

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_647880.1 Gene:CG1309 / 38519 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster


Alignment Length:246 Identity:58/246 - (23%)
Similarity:93/246 - (37%) Gaps:63/246 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 GGTVVLYLHGNTASRGSGHRSEVYKLLRKLNYHVFSFDYRGYADSDPVP-PTEEGVVRDAMMVFE 243
            |.|:|:...||......|    :......|.|.|..:::.|:|.|...| |.::....||  |.:
  Fly   242 GKTLVICSEGNAGFYEVG----IMATPVALKYSVLGWNHPGFAGSTGTPHPHQDKNAIDA--VVQ 300

  Fly   244 YIANTTSNP---IVVWGHSLGTGVATHLCAKLASLRERAP--RGVILESPFTNIRDEIRMHPFAK 303
            :..|....|   |:::|.|:| |.:|...|.:      .|  :||:|::.|.::           
  Fly   301 FAINNLRFPVEDIILYGWSIG-GFSTLYAASV------YPDVKGVVLDATFDDV----------- 347

  Fly   304 LYKNLPWFNFTIS---QPMYTNRLRFESDVHVLEFRQPIMII-HAEDDVV-----VPFNLGYRLY 359
            ||..:|.....::   :....|.....:.....||..||..| ..||:::     :..|.|..|.
  Fly   348 LYLAVPRMPAALAGIVKVAIRNYCNLNNAELANEFNGPISFIRRTEDEIIAEDNHIDTNRGNFLV 412

  Fly   360 RIALDGRSRTSGPVEFHR----FGASRKYGHKYLCRAPELPGLIQKFVENY 406
            ...|.           ||    ||||:....|         ||:.|.:|.|
  Fly   413 LSVLK-----------HRYPNIFGASQLNKAK---------GLLSKPLEPY 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 48/216 (22%)
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 32/134 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468271
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12277
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.