DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and Abhd17a

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001006984.1 Gene:Abhd17a / 299617 RGDID:1359682 Length:310 Species:Rattus norvegicus


Alignment Length:191 Identity:51/191 - (26%)
Similarity:81/191 - (42%) Gaps:39/191 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 MPGGT-VVLYLHGNTASRGSGHRSEVYKLLRKLNYHVFSFDYRGYADSDPVPPTEEGVVRDAMMV 241
            :||.. .||:.|||....|. ..|....|..::..::||:||.||..|.. .|:|:.:..|....
  Rat   107 VPGARYTVLFSHGNAVDLGQ-MCSFYVGLGTRIGCNIFSYDYSGYGISSG-RPSEKNLYADIDAA 169

  Fly   242 FEYIA---NTTSNPIVVWGHSLGTGVATHLCAKLASLRERAPRGVILESPFTN-----IRDEIRM 298
            ::.:.   ..:.:.|:::|.|:|| |.|   ..|||..|.|  .|:|.||.|:     ..|..:.
  Rat   170 WQALRTRYGISPDSIILYGQSIGT-VPT---VDLASRYECA--AVVLHSPLTSGMRVAFPDTKKT 228

  Fly   299 HPFAKLYKNLPWFNFTISQPMYTNRLRFESDVHVLEFRQPIMIIHAEDDVVVPFNLGYRLY 359
            :.|.                      .|.:...|.:...|::|||..:|.|:.|:.|..||
  Rat   229 YCFD----------------------AFPNIEKVSKITSPVLIIHGTEDEVIDFSHGLALY 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 49/185 (26%)
Abhd17aNP_001006984.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..61
FrsA <113..305 CDD:223999 49/185 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D691954at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.