DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and Acot6

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001292214.1 Gene:Acot6 / 299193 RGDID:1309669 Length:422 Species:Rattus norvegicus


Alignment Length:335 Identity:71/335 - (21%)
Similarity:113/335 - (33%) Gaps:110/335 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LIFVVLPLIFRYSVTF------QRGILFLTFIKY--------------PKGLDLTKPESVGLYAT 88
            |..|:..|....|||.      ::|:||.....|              ..|...|..|.:||   
  Rat    19 LSIVLSGLAPEQSVTLCSALRDEKGVLFRAHALYRADVQGELNLALAPALGGSFTGLEPMGL--- 80

  Fly    89 RNFYITVKDHDQDEDGVRVGVWHVLPSNAV-RRFKRELR----VEEEV--AQDPD--QQLDPAPG 144
                                :|.:.|.... |..||:::    ||.||  ..:||  |:|..|. 
  Rat    81 --------------------IWAMEPERPFWRLIKRDVQTPLVVELEVLDGHEPDGGQRLAQAV- 124

  Fly   145 NERELKELSPAIRSEFPVVLPENEQLFYERLLRMPG-----GTVVLY-----LHGNTASRGSGHR 199
            :||..  ::|.:|.     :|..|......|...||     |.:.||     |....||..:||.
  Rat   125 HERHF--MAPGVRR-----VPVREGRVRATLFLPPGEGQFSGIIDLYGSIGGLREYRASLLAGHG 182

  Fly   200 SEVYKLLRKLNYHVFSFDYRGYADSDPVPPTEEGVVRDAMMVFEYIANTTSNPIVVWGHSLG-TG 263
            ..|..|              .|...:.:|   |.:.:..:..||.......:...|.|.::| .|
  Rat   183 FAVLAL--------------AYFQFEDLP---EYLSQVHLEYFEEAVTFMLHHPQVKGPNIGLLG 230

  Fly   264 VAT--HLCAKLAS-LRERAPRGVILESPFTNIRDEIRMHPFAKLYKNLPWFNFTISQPMYTNRLR 325
            ::.  .||..:|: |:::....|::.:...|        ..|.||          .:.|:...|.
  Rat   231 ISKGGDLCLSMAAFLKDKITATVLINACVAN--------TLAPLY----------YKDMFIPNLG 277

  Fly   326 FESDVH-VLE 334
            ::...| :||
  Rat   278 YDPTKHKILE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 32/162 (20%)
Acot6NP_001292214.1 Bile_Hydr_Trans 17..137 CDD:282610 33/148 (22%)
Aes 83..373 CDD:223730 55/248 (22%)
BAAT_C 203..413 CDD:285986 20/103 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.