DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and Baat

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_058996.2 Gene:Baat / 29725 RGDID:2190 Length:420 Species:Rattus norvegicus


Alignment Length:432 Identity:83/432 - (19%)
Similarity:128/432 - (29%) Gaps:169/432 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LRSVFLATLIPGTILLSWLTGLVGLR--CLQACLLIFFLIFVVLPLIFRYSVTFQRGILFLTFIK 70
            |.:|.|:.|:...:.:. :|||...:  ||||                  |:...:|.||.:...
  Rat     4 LTAVPLSALVDEPVHIR-VTGLTPFQVVCLQA------------------SLKDDKGNLFNSQAF 49

  Fly    71 YPKG----LDLTKPESVGLYATRNFYITVKDHDQDEDGVRVGV------WHVLPSNAVRRFKREL 125
            |...    :||.:..|:|                   |..:||      |.:.|...:.|.    
  Rat    50 YRASEVGEVDLERDSSLG-------------------GDYMGVHPMGLFWSMKPEKLLTRL---- 91

  Fly   126 RVEEEVAQDPDQQLDPAPGNERELKELSPAIRSEFPVVLPENEQLFYERLLRMPGGTVVLYLHGN 190
             |:.:|...|         ::..:|...|....|..|:....:.|..||....||.|.:....|.
  Rat    92 -VKRDVMNRP---------HKVHIKLCHPYFPVEGKVISSSLDSLILERWYVAPGVTRIHVKEGR 146

  Fly   191 TASR------------------GSGHRSEV-YKLLRKLNYHVFSFDYRGYADSDPVPPT------ 230
            ....                  |:|...|. ..||....:...:..|.||   |.:|..      
  Rat   147 IRGALFLPPGEGPFPGVIDLFGGAGGLFEFRASLLASHGFATLALAYWGY---DDLPSRLEKVDL 208

  Fly   231 ---EEGVVRDAMMVFEYIANTTSNPIVVWGHSLGTGV-------ATHLCAKLASLRERAPRGVIL 285
               ||||        |::..   :|.|     ||.||       ...:...:|...::....|::
  Rat   209 EYFEEGV--------EFLLR---HPKV-----LGPGVGILSVCIGAEIGLSMAINLKQITATVLI 257

  Fly   286 ESPFTNIRDEIRMHPFAKLYKNLPWFNFTISQPMYTNRLRFESDVHVLEFR--QPIMIIHAEDDV 348
            ..|                       ||..|.|            ||...:  ||   ....::.
  Rat   258 NGP-----------------------NFVSSNP------------HVYRGKVFQP---TPCSEEF 284

  Fly   349 VVPFNLG----YRLYRIALDGRSRTSGPVEFHRFGASRKYGH 386
            |....||    ||.:....|..|:...|:|       :.:||
  Rat   285 VTTNALGLVEFYRTFEETADKDSKYCFPIE-------KAHGH 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 42/238 (18%)
BaatNP_058996.2 Bile_Hydr_Trans 14..140 CDD:398442 35/177 (20%)
BAAT_C 206..414 CDD:400960 33/175 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.