DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and Acot1

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_036136.1 Gene:Acot1 / 26897 MGIID:1349396 Length:419 Species:Mus musculus


Alignment Length:297 Identity:66/297 - (22%)
Similarity:103/297 - (34%) Gaps:91/297 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PLIFRYSVTFQRGILFLTFIKYPKG----LDLTKPESVGLYATRNFYITVKDHDQDEDGVRVG-- 108
            |:..|..:..::|.||....:|...    |||.:..::|                   |...|  
Mouse    31 PVTLRSVLRDEKGALFRAHARYRADSHGELDLARTPALG-------------------GSFSGLE 76

  Fly   109 ----VWHVLPSNAV-RRFKRELR----VEEEV--AQDPD--QQLDPAPGNERELKELSPAIRSEF 160
                :|.:.|.... |..||:::    ||.||  ..:||  |:|..|. :||..  |:|.:| ..
Mouse    77 PMGLLWAMEPDRPFWRLVKRDVQTPFVVELEVLDGHEPDGGQRLAHAV-HERHF--LAPGVR-RV 137

  Fly   161 PV---------VLPENEQLFYERLLRMPGGTVVLYLHGNTASRGSGHRSEVYKLLRKLNYHVFSF 216
            ||         .||.....|       ||   ::.|.|    .|.|.......||....:.|.:.
Mouse   138 PVREGRVRATLFLPPEPGPF-------PG---IIDLFG----VGGGLLEYRASLLAGKGFAVMAL 188

  Fly   217 DYRGYADSDPVPPTEEGVVRDAMMVFEYIANTTSNPIVVWGHSLG-TGVAT--HLCAKLASLRER 278
            .|..|   |.:|...|.:   .|..||...|...:...|.|..:| .|::.  .|...:||..:.
Mouse   189 AYYNY---DDLPKNMETM---HMEYFEEAVNYLRSHPEVKGPGIGLLGISKGGELGLAMASFLKG 247

  Fly   279 APRGVILES-----------------PFTNIRDEIRM 298
            ....|::..                 |.|.:|::::|
Mouse   248 ITAAVVINGSVAAVGNTISYKDETIPPVTILRNQVKM 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 28/136 (21%)
Acot1NP_036136.1 Bile_Hydr_Trans 16..137 CDD:377407 31/128 (24%)
Abhydrolase 145..>257 CDD:389770 29/131 (22%)
BAAT_C 204..410 CDD:370148 16/81 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.