DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and bem46

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_595609.1 Gene:bem46 / 2540264 PomBaseID:SPBC32H8.03 Length:299 Species:Schizosaccharomyces pombe


Alignment Length:348 Identity:78/348 - (22%)
Similarity:125/348 - (35%) Gaps:101/348 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VVLPLIFRYSVTFQRGILFLTFIKYPKGLDLTKPESVGLYATRNFYITVKDHDQDEDGVRVGVWH 111
            :.|..:::|..|          :.||........|:|.         |.|:.:.:.:.:      
pombe    26 IALGFLYKYQKT----------LVYPSAFPQGSRENVP---------TPKEFNMEYERI------ 65

  Fly   112 VLPSNAVRRFKRELRVEEEVAQDPDQQLDPAPGNERELKELSPAIRSEFPVVLPENEQLFYERLL 176
                        |||..::|..|....|                 :||.|...|           
pombe    66 ------------ELRTRDKVTLDSYLML-----------------QSESPESRP----------- 90

  Fly   177 RMPGGTVVLYLHGNTASRGSGHRSEVYKLL-RKLNYHVFSFDYRGYADSDPVPPTEEGVVRDAMM 240
                  .:||.|.|..:  .|||..:.::. ..||.:||...||||..|.. .|:|.|:..|:..
pombe    91 ------TLLYFHANAGN--MGHRLPIARVFYSALNMNVFIISYRGYGKSTG-SPSEAGLKIDSQT 146

  Fly   241 VFEYIAN---TTSNPIVVWGHSLGTGVATHLCAKLASLRERAPRGVILESPFTNIRDEIRMHPFA 302
            ..||:..   .:...|||:|.|:|..||..|.||    .:.....:|||:.||:|:|   |.|..
pombe   147 ALEYLMEHPICSKTKIVVYGQSIGGAVAIALTAK----NQDRISALILENTFTSIKD---MIPTV 204

  Fly   303 KLYKNLPWFNFTISQPMYTNRLRFESDVHVLEFRQPIMIIHAEDDVVVPFNLGYRLYRIALDGRS 367
                 .|:....||: ..|.....:.::..:: :.|::.:..|.|.:||......|:.:.     
pombe   205 -----FPYGGSIISR-FCTEIWSSQDEIRKIK-KLPVLFLSGEKDEIVPPPQMVLLFGLC----- 257

  Fly   368 RTSGPVEFHRFGASRKYGHKYLC 390
             .|...:||.|   .|..|...|
pombe   258 -GSAKKKFHSF---PKCTHNDTC 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 56/201 (28%)
bem46NP_595609.1 FrsA 7..292 CDD:223999 78/348 (22%)
Abhydrolase_5 91..273 CDD:289465 57/207 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.