DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and Acot6

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_766168.1 Gene:Acot6 / 217700 MGIID:1921287 Length:419 Species:Mus musculus


Alignment Length:442 Identity:86/442 - (19%)
Similarity:144/442 - (32%) Gaps:166/442 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PLIFRYSVTFQRGILFLTFIKYPKG----LDLTKPESVGLYATRNFYITVKDHDQDEDGVRVG-- 108
            |:..|..:..::|:||....:|...    |||.:..::|                   |...|  
Mouse    31 PVTLRSVLRDEKGMLFRAHARYRADSHGELDLARTPALG-------------------GSFSGLE 76

  Fly   109 ----VWHVLPSNAV-RRFKRELR----VEEEV--AQDPD--QQLDPAPGNERELKELSPAIRSEF 160
                :|.:.|.... |..||:::    ||.||  ..:||  |:|..|. :||..  ::|.:|.  
Mouse    77 PMGLLWAMEPDRPFWRLIKRDVQIPFVVELEVLDGHEPDGGQRLARAV-HERHF--MAPGVRR-- 136

  Fly   161 PVVLPENEQLFYERLLRMPG-----GTVVLY-----LHGNTASRGSGHRSEVYKLLRKLNYHVFS 215
               :|..|......|...||     |.:.||     |..:.||..:||...|..|          
Mouse   137 ---VPVREGRVRATLFLPPGKGQFPGIIDLYGSIGGLCEHRASLLAGHGFAVLAL---------- 188

  Fly   216 FDYRGYADSDPVPPTEEGVVRDAMMVF--EYIANTTSNPIVVWGHSLG-TGVA--THLCAKLAS- 274
                .|...:.:|..    :.|..:.:  |.:|....:| .|.|.::| .||:  ..||..:|: 
Mouse   189 ----AYFQFEDLPEN----LSDVRLEYFEEALALMLRHP-QVKGPNIGLIGVSKGADLCLSMAAF 244

  Fly   275 LRERAPRGVILESPFTNIRDEIRMHPFAKLYKNL--------------------PWFNFTISQPM 319
            |::.....|::.:...|     .:.|.  .||:|                    ..:|..:.:|.
Mouse   245 LKDNITATVLINACVAN-----TLVPL--YYKDLFVPELGCDQTKNKSGLMDLRDMWNNPLEEPN 302

  Fly   320 YTNRLRFE------------------SDV--------------------------HVLE---FRQ 337
            :.:.:..|                  |||                          |.:|   |..
Mouse   303 HQSLIPLEKAQGPFLFLVGMDDHNWKSDVYARIACERLQAHGKDRPQIIYYPETGHCIEPPYFPP 367

  Fly   338 PIMIIHAEDDVVVPFNLGYRLYRIALDGRSRTSGPVEFHRFGASRKYGHKYL 389
            ||..:|        |.||..::.   .|:.|.....:...:...:.:..|||
Mouse   368 PIATVH--------FVLGEAVFN---GGKPRAQSRAQLDAWQRIQTFFQKYL 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 47/275 (17%)
Acot6NP_766168.1 Bile_Hydr_Trans 17..137 CDD:282610 30/132 (23%)
Aes 83..374 CDD:223730 65/332 (20%)
BAAT_C 203..410 CDD:285986 38/225 (17%)
Microbody targeting signal. /evidence=ECO:0000255 417..419
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.