DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and K05B2.4

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_508837.3 Gene:K05B2.4 / 187017 WormBaseID:WBGene00019404 Length:431 Species:Caenorhabditis elegans


Alignment Length:248 Identity:52/248 - (20%)
Similarity:79/248 - (31%) Gaps:87/248 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 LSPAIRSEFPVVLPENEQLFYERLLRMPGGTVVLYLHGNTASRGSGHRSEVYKLLRKLNYHVFSF 216
            :||.|     :|.|| :.|.:|.:..:..|  :.|...........|:..:|:     :|.||..
 Worm     1 MSPVI-----LVTPE-DSLVHENVSIVVNG--LEYQKNYLLELRLLHKVGIYR-----SYGVFKS 52

  Fly   217 DYRGYADSDPVPP---TEEGVVRDAMMVFEYIANTTS---------NPIVVWGHSL------GTG 263
            ...|..|...:.|   |..||....:  ||.:..|.:         .|.|.:.:.|      ||.
 Worm    53 TVTGCIDLSKIAPIRGTYSGVNESGL--FESLEPTDTVRYGGYCNCTPPVDFKYQLLVKNLNGTV 115

  Fly   264 VA-THLCAKL-------ASLRERAPRGVILE-------------SPFTNIRD------------- 294
            :. ..||.:|       ..:.|..|.|...:             .||..|.|             
 Worm   116 LGEKSLCRRLMHPLVERIEVEEAYPEGTTGKPKVTGTMFKPPGNGPFPTIIDISGTGGGLNEQKG 180

  Fly   295 -EIRMHPFAKL------YKNLPW-------------FNFTISQPMYTNRLRFE 327
             .:....||.|      ||:||:             .||..|.|...:|:.|:
 Worm   181 AALASRGFAVLCLAFFKYKDLPYELQEVELRYFEDAINFVTSLPYTNDRIGFQ 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 43/217 (20%)
K05B2.4NP_508837.3 Bile_Hydr_Trans 16..133 CDD:282610 25/125 (20%)
BAAT_C 208..417 CDD:285986 6/26 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.