DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and Acot4

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_599008.3 Gene:Acot4 / 171282 MGIID:2159621 Length:421 Species:Mus musculus


Alignment Length:364 Identity:72/364 - (19%)
Similarity:114/364 - (31%) Gaps:134/364 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PLIFRYSVTFQRGILFLTFIKYPKG----LDLTKPESVGLYATRNFYITVKDHDQDEDGVRVG-- 108
            |:..|..:..::|.||....:|...    |||.:..::|                   |...|  
Mouse    31 PVTLRSVLRDEKGALFRAHARYRADSHGELDLARVPALG-------------------GSFSGLE 76

  Fly   109 ----VWHVLPSNAV-RRFKRELR----VEEEV--AQDPDQQLDPAPGNER------ELKELSPAI 156
                :|.:.|.... |..||:::    ||.||  ..:||       |..|      |...::|.:
Mouse    77 PMGLLWAMEPDRPFWRLIKRDVQTPFLVELEVLDGHEPD-------GGRRLARTVHERHFMAPGV 134

  Fly   157 RSEFPVVLPENEQLFYERLLRMP--------------GGTVVLYLHGNTASRGSGHRSEVY---- 203
            |.     :|..|......|...|              ||.::.|..|..|..|....:..:    
Mouse   135 RR-----VPVREGRVRATLFLPPGQGPFPGIIDVYGVGGGLLEYRAGLVAGHGFATLALAFYDFE 194

  Fly   204 KLLRKLNYHVFSFDYRGYADSDPVPPTEEGVVRDAMMVFEYIAN--TTSNP-IVVWGHSLGTGVA 265
            .|.::||  |...||           .||.|        .|:..  ....| |.:.|.|||..| 
Mouse   195 DLPKELN--VIEVDY-----------FEEAV--------RYMLRHPKVKGPDIGLLGLSLGADV- 237

  Fly   266 THLCAKLASLRERAPRGVILE-SPFTNIRDEIRMHPFAKLYKN--LPWFNFTISQPMYTNRLRFE 327
               |..:||........|.:. |.|:..| .|:       ||.  :|    .:...:...::.|.
Mouse   238 ---CLIMASFLNNVSATVSINGSAFSGNR-HIK-------YKQTMIP----PLGHDLRRMKVAFS 287

  Fly   328 SDVHVLEFRQ-------------------PIMIIHAEDD 347
            ..:.:::.|.                   ||:.:..:||
Mouse   288 GILDIVDIRNDAVGGCENPSMIPIEKAKGPILFVAGQDD 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 38/194 (20%)
Acot4NP_599008.3 Bile_Hydr_Trans 16..137 CDD:377407 28/136 (21%)
Abhydrolase 137..>253 CDD:389770 30/140 (21%)
BAAT_C 204..412 CDD:370148 30/158 (19%)
Microbody targeting signal. /evidence=ECO:0000255 419..421
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.