DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and ACOT4

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_689544.3 Gene:ACOT4 / 122970 HGNCID:19748 Length:421 Species:Homo sapiens


Alignment Length:374 Identity:70/374 - (18%)
Similarity:123/374 - (32%) Gaps:118/374 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 RYSVTFQRGILFLTFIKY---PKG-LDLTKPESVGLYATRNFYITVKDHDQDEDGVRVG------ 108
            |.|:..::|.||....:|   .:| |||.:..::|                   |...|      
Human    35 RASLRDEKGALFRAHARYCADARGELDLERAPALG-------------------GSFAGLEPMGL 80

  Fly   109 VWHVLPSNAVRRF-KRELRVEEEVAQDPDQQLDPAPGN-----ERELKELSPAIRSE-------- 159
            :|.:.|.....|| ||::::...|..:.....||.||.     :.|...|.|.:|.:        
Human    81 LWALEPEKPFWRFLKRDVQIPFVVELEVLDGHDPEPGRLLCQAQHERHFLPPGVRRQSVRAGRVR 145

  Fly   160 FPVVLPENEQLFYERLLRMPGGTVVLYLHGN----TASRGSGHRSEVYKLLRKLNYHVFSFDYRG 220
            ..:.||.....|       ||...:..:.|.    .||..:||           .:...:..|..
Human   146 ATLFLPPGPGPF-------PGIIDIFGIGGGLLEYRASLLAGH-----------GFATLALAYYN 192

  Fly   221 YADSDPVPPTEEGVVRDAMMVF-EYIANTTSNP------IVVWGHSLGTGVATHLCAKLASLRER 278
            :.|   :|...:.:   ::..| |.:.....:|      |.:.|.|||..:    |..:||..:.
Human   193 FED---LPNNMDNI---SLEYFEEAVCYMLQHPQVKGPGIGLLGISLGADI----CLSMASFLKN 247

  Fly   279 APRGVILESPFTNIRDEIRMHPFAKLYK--NLPWFNFTISQPMYTNRLRFESDVHVLEFRQ---- 337
            ....|.:.....:....|.       ||  ::|...:.:.:    .::.|...|.:::.|.    
Human   248 VSATVSINGSGISGNTAIN-------YKHSSIPPLGYDLRR----IKVAFSGLVDIVDIRNALVG 301

  Fly   338 ---------------PIMIIHAEDDVVVPFNLGYRLYRIALDGRSRTSG 371
                           ||::|..:||    .|....||...:..|.:..|
Human   302 GYKNPSMIPIEKAQGPILLIVGQDD----HNWRSELYAQTVSERLQAHG 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 37/221 (17%)
ACOT4NP_689544.3 Bile_Hydr_Trans 17..137 CDD:377407 28/120 (23%)
BAAT_C 205..412 CDD:370148 29/161 (18%)
Microbody targeting signal. /evidence=ECO:0000255 419..421
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.