DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and ACOT2

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_006812.3 Gene:ACOT2 / 10965 HGNCID:18431 Length:483 Species:Homo sapiens


Alignment Length:314 Identity:74/314 - (23%)
Similarity:107/314 - (34%) Gaps:97/314 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PLIFRYSVTFQRGILFLTFIKYPKG----LDLTKPESVGLYATRNFYITVKDHDQDEDGVRVG-- 108
            |:..|.|:..::|.||....:|...    |||.:..::|                   |...|  
Human    93 PVTLRASLRDEKGALFQAHARYRADTLGELDLERAPALG-------------------GSFAGLE 138

  Fly   109 ----VWHVLPSN-AVRRFKRELR----VEEEV--AQDPDQQLDPAPG-----NERELKELSPAIR 157
                :|.:.|.. .||..||::|    ||.||  ..|||      ||     ...|...|.|.:|
Human   139 PMGLLWALEPEKPLVRLVKRDVRTPLAVELEVLDGHDPD------PGRLLCQTRHERYFLPPGVR 197

  Fly   158 SEFPV---------VLPENEQLFYERLLRMPGGTVVLYLHGNTASRGSGHRSEVYKLLRKLNYHV 213
            .| ||         .||.....|       ||   ::.:.|.    |.|.......||....:.|
Human   198 RE-PVRVGRVRGTLFLPPEPGPF-------PG---IVDMFGT----GGGLLEYRASLLAGKGFAV 247

  Fly   214 FSFDYRGYADSDPVPPTEEGVVRDAMMVFEYIANTTSNPIVVWGHSLG-TGVAT--HLCAKLASL 275
            .:..|..|.|   :|.|.|.:   .:..||...|...:...|.|..:| .|::.  .||..:||.
Human   248 MALAYYNYED---LPKTMETL---HLEYFEEAMNYLLSHPEVKGPGVGLLGISKGGELCLSMASF 306

  Fly   276 RERAPRGVILESPFTNIRDEIRMHPFAKLYK--NLPWFNFTISQPMYTNRLRFE 327
            .:.....|::.....|:...:.       ||  .||        |:..||.|.:
Human   307 LKGITAAVVINGSVANVGGTLH-------YKGETLP--------PVGVNRNRIK 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 33/150 (22%)
ACOT2NP_006812.3 Bile_Hydr_Trans 79..198 CDD:282610 32/129 (25%)
Abhydrolase 207..>319 CDD:304388 29/131 (22%)
BAAT_C 266..474 CDD:285986 21/95 (22%)
Microbody targeting signal. /evidence=ECO:0000255 481..483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.