DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15118 and ankrd13a

DIOPT Version :9

Sequence 1:NP_611396.1 Gene:CG15118 / 37199 FlyBaseID:FBgn0034418 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001011011.1 Gene:ankrd13a / 496420 XenbaseID:XB-GENE-998906 Length:245 Species:Xenopus tropicalis


Alignment Length:245 Identity:104/245 - (42%)
Similarity:158/245 - (64%) Gaps:5/245 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSVEEIKAEYPLHWHIWHNELEQLQAAIDQNDKEKIDPRGRTPLMLAVRLANLPCVKCLLAAKC 65
            |.|.||..::||:|..:|.|:...|::.:...|.|::||||||||.|||.|.:|...:.||..|.
 Frog     1 MSSTEEPSSDYPIHALVWRNDYRSLESELQGKDIEQLDPRGRTPLHLAVSLGHLETARVLLRHKA 65

  Fly    66 NATYE-YEGWSIVQEAVCTGDVDILTAIIEVRDLQRHVQRVTHVPKLLQHLLDAPDFYIEMKWEF 129
            :.|.| .:||:::.|||.|||.:::..:::.|:..:....:..||:||:..|:|.|||:||||||
 Frog    66 DVTKENRDGWTVLHEAVSTGDPEMVQMVLQYREFHKASTALGGVPELLKKTLEASDFYVEMKWEF 130

  Fly   130 TSWVPLMSRLCPSDTYKVYKRGANVRIDTTLLGFDNNTWQRGNRSYIFKGAKETATMIEIDHDTN 194
            ||||||:||:||||..:::|.||.:|:|.|||||:|..|.||..|:|||.....|.::||:||..
 Frog   131 TSWVPLLSRVCPSDVCRIWKSGAKLRVDATLLGFENMNWIRGKHSFIFKEEDNWAELMEINHDDK 195

  Fly   195 EVMVE--EMSSDIGDIV--AIPPALGTVRARLNAPVITNNIEMDKISFER 240
            .|..|  ::|.:|..|.  ::.||...:..||.:|:|..:::...|:|||
 Frog   196 TVTKERFDISQEIEGITLDSMQPAEREISKRLTSPIINTSLDTKTIAFER 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15118NP_611396.1 ANK 10..>94 CDD:238125 34/84 (40%)
ANK repeat 12..38 CDD:293786 7/25 (28%)
Ank_2 13..94 CDD:289560 32/81 (40%)
ANK repeat 40..70 CDD:293786 15/29 (52%)
GPCR_chapero_1 155..497 CDD:288735 35/90 (39%)
vWFA <558..627 CDD:294047
ankrd13aNP_001011011.1 ANK 12..>97 CDD:238125 33/84 (39%)
ANK repeat 12..38 CDD:293786 7/25 (28%)
ANK repeat 40..71 CDD:293786 15/30 (50%)
GPCR_chapero_1 156..>245 CDD:314733 33/88 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 279 1.000 Domainoid score I1668
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 475 1.000 Inparanoid score I1452
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D425969at2759
OrthoFinder 1 1.000 - - FOG0000585
OrthoInspector 1 1.000 - - otm47603
Panther 1 1.100 - - O PTHR12447
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X742
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.