DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15118 and CG5742

DIOPT Version :9

Sequence 1:NP_611396.1 Gene:CG15118 / 37199 FlyBaseID:FBgn0034418 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001261069.1 Gene:CG5742 / 37072 FlyBaseID:FBgn0034304 Length:585 Species:Drosophila melanogaster


Alignment Length:546 Identity:153/546 - (28%)
Similarity:269/546 - (49%) Gaps:90/546 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EYPLHWHIWHNELEQLQAAI----DQNDKEKIDPRGRTPLMLAVRLANLPCVKCLLAAKCNATYE 70
            ::|:|..::.::::.||..:    .|::..:.|..|.|||.|||.|.....|:.|||.  ||..:
  Fly    84 DFPMHRSVFEDDIKSLQRRLLLSTAQDEVGRKDKHGNTPLHLAVMLGRKHAVRLLLAQ--NAPVK 146

  Fly    71 Y---EGWSIVQEAVCTGDVDILTAIIEVRDLQRHVQRVTHVPKLLQHLLDAPDFYIEMKWEFTSW 132
            .   ||||.:.||:..||...:|.::.:..||......:...||:..|....|||:|.||:|.||
  Fly   147 IKNNEGWSPLSEAISYGDRQTITQVLRMLKLQSREHMESRREKLVNALRQMQDFYMEFKWDFQSW 211

  Fly   133 VPLMSRLCPSDTYKVYKRGANVRIDTTLLGFDNNTWQRGNRSYIFKG---AKETATMIEIDHDT- 193
            :||:||:.|||..::||.||::|:||||:.|::..|:||:.|::|:|   |:|:..:::.:.:. 
  Fly   212 LPLVSRILPSDICRLYKSGASIRLDTTLVDFNDMRWERGDISFLFRGEAPARESLVLLDNEQECF 276

  Fly   194 NEVMVEEMSSDIGDIVAIPPALGTVRARLNAPVITNNIEMDKISFERNKCGIWGWRSEKSEMING 258
            ..:..||  ||:.|.|.:         .::..::...:....|.|.|.:.| |.:|:.:.|:|.|
  Fly   277 QRLRYEE--SDMEDEVDV---------LMSTDILATQMSTKTIQFARAQRG-WIFRANRKELIGG 329

  Fly   259 -YNCKVYGASNVEFVTKTRMDHLSEEQIKNKTARTPLHSLLGIADEDYVSPADAAAALKDRTPSP 322
             |.|::|....:....:.|.:|||.|.::..  |..:.::...|.:...:...:..:....||..
  Fly   330 QYQCEIYTIQGLILKQRKRREHLSHEDLQKN--RAIVETITKGASQQPDTRRSSLGSQHTATPPE 392

  Fly   323 RLEEASNAGVENGGRNSP-APGNQSNGSS-----AGASGTSTPKSSVTPEEYFTQEFDLHGRDVG 381
                          .|:| ||    ||.|     ..:|..:.|..:||..:|...|       ||
  Fly   393 --------------TNTPTAP----NGISLPELPRRSSLQAPPPPTVTWRQYLDAE-------VG 432

  Fly   382 G-PKNLSTKVQR-----FRANLWLAEEHPIRLQEQVLPILDLMSTMASPHVSKLRDFITMQLPAG 440
            . |:...|.|.:     .||.:.::::.|:.: :.:|.:|::::.:  .|::|||:|:|::||.|
  Fly   433 KCPQLGRTPVHKQSNKTLRATVAMSKDFPLSV-DMLLDVLEVVAPL--KHINKLREFVTLKLPTG 494

  Fly   441 FPVKVEIPLFHVLNACITFGNVFALTTPVDHVATLQEQDRVTCLVDDRCFDIPAHYTNRGSDVRR 505
            ||||:|||:.|.:.|.:||             ...:.:|.:..    :.|::|:||   ..||||
  Fly   495 FPVKIEIPVLHTVTAKVTF-------------QKFEFRDNIPA----KMFEVPSHY---WEDVRR 539

  Fly   506 QIPLDEDDMLQYAIEQSLVETSGACG 531
            ...| ..|  ..|..::...|.|..|
  Fly   540 FQDLXPGD--GEAAPKAKAATGGPTG 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15118NP_611396.1 ANK 10..>94 CDD:238125 29/90 (32%)
ANK repeat 12..38 CDD:293786 5/29 (17%)
Ank_2 13..94 CDD:289560 28/87 (32%)
ANK repeat 40..70 CDD:293786 14/29 (48%)
GPCR_chapero_1 155..497 CDD:288735 88/358 (25%)
vWFA <558..627 CDD:294047
CG5742NP_001261069.1 ANK 86..>175 CDD:238125 29/90 (32%)
ANK repeat 86..116 CDD:293786 5/29 (17%)
Ank_5 104..156 CDD:290568 20/53 (38%)
ANK repeat 118..149 CDD:293786 14/32 (44%)
GPCR_chapero_1 234..534 CDD:288735 89/361 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449866
Domainoid 1 1.000 44 1.000 Domainoid score I4699
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D425969at2759
OrthoFinder 1 1.000 - - FOG0000585
OrthoInspector 1 1.000 - - mtm1007
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12447
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.