DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment botv and GUT2

DIOPT Version :10

Sequence 1:NP_523790.1 Gene:botv / 37198 FlyBaseID:FBgn0027535 Length:972 Species:Drosophila melanogaster
Sequence 2:NP_174064.1 Gene:GUT2 / 839635 AraportID:AT1G27440 Length:412 Species:Arabidopsis thaliana


Alignment Length:136 Identity:33/136 - (24%)
Similarity:62/136 - (45%) Gaps:23/136 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   500 RIYEALRSGAVPVILGADELRLPYAETVDWRRTALLLPKARITELHFLLRAVQDADLLLLRRQGR 564
            |:.||:..|.:|||: ||::.||:|:.:.|....:.:.:..:.||..:|.::...  ::||:|  
plant   290 RLVEAVVFGCIPVII-ADDIVLPFADAIPWEEIGVFVAEKDVPELDTILTSIPTE--VILRKQ-- 349

  Fly   565 LIWERYLSSVQATVDTVIASLRDRLGIPPRPVPSVIAQSVFNSTFIPLKSDPPVGLDTEPEESL- 628
                |.|::         .|::..:..|....|......:.|.....|..|..:.|.| .|::| 
plant   350 ----RLLAN---------PSMKRAMLFPQPAQPGDAFHQILNGLARKLPHDKSIYLKT-GEKALN 400

  Fly   629 ---GPI 631
               ||:
plant   401 WTAGPV 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
botvNP_523790.1 CC_brat-like 106..>179 CDD:475168
Exostosin 224..551 CDD:397245 16/50 (32%)
Glyco_transf_64 714..953 CDD:430488
GUT2NP_174064.1 Exostosin 45..340 CDD:397245 16/50 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.