DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment botv and MUR3

DIOPT Version :9

Sequence 1:NP_523790.1 Gene:botv / 37198 FlyBaseID:FBgn0027535 Length:972 Species:Drosophila melanogaster
Sequence 2:NP_179627.2 Gene:MUR3 / 816556 AraportID:AT2G20370 Length:619 Species:Arabidopsis thaliana


Alignment Length:400 Identity:86/400 - (21%)
Similarity:132/400 - (33%) Gaps:137/400 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 LYSLPYWGGD---GRNHVL----LNLARRDLTSHRT---NPLY----RQNTMRAIVVQSAFEREQ 370
            |...|.|  |   |::|.|    :....|.|:...|   |.|.    .:|....:|..|.:....
plant   272 LMKRPEW--DIMRGKDHFLVAGRITWDFRRLSEEETDWGNKLLFLPAAKNMSMLVVESSPWNAND 334

  Fly   371 FRPGYDLIVPPILGPPGGD----VWQECAEMVPARRKYLLTYQGELRPKQSSLNPLDAFILEHLA 431
            |...|     |....|..|    .||:  .|....||:|.::.|..||.    ||..  |...:.
plant   335 FGIPY-----PTYFHPAKDSEVFEWQD--RMRNLERKWLFSFAGAPRPD----NPKS--IRGQII 386

  Fly   432 DMAKGATQDQFVLQFQCVPATEQQEGDSLPDWTLCGSDSSRRQLLKDSTFSLILPPLNGRVSSTL 496
            |..:.:...:.:         |...|:|     .|.:.||..|:.:.|.|  .|.|...  |.|.
plant   387 DQCRNSNVGKLL---------ECDFGES-----KCHAPSSIMQMFQSSLF--CLQPQGD--SYTR 433

  Fly   497 MLARIYEALRSGAVPVILGADELRLPYAETVDWRRTALLLPKARITELHFLLRAVQDADLLLLRR 561
            ..|  ::::.:|.:||..........|.    |.     |||...|...|    :.:.|   :|:
plant   434 RSA--FDSMLAGCIPVFFHPGSAYTQYT----WH-----LPKNYTTYSVF----IPEDD---VRK 480

  Fly   562 QGRLIWERYLSSVQATVDTVIASLRDRLGIPPRPVPSVIAQSVFNSTFIP--LKSDPPVGLDTEP 624
            :...|.||.|.                  ||.:.| .::.::|.|  .||  :.:||...|:|:.
plant   481 RNISIEERLLQ------------------IPAKQV-KIMRENVIN--LIPRLIYADPRSELETQK 524

  Fly   625 EESLGPIEPPYPSPAF--------------RRN------------------YTILRMQAKEAWND 657
            :             ||              |:|                  |.:|....:||...
plant   525 D-------------AFDVSVQAVIDKVTRLRKNMIEGRTEYDYFVEENSWKYALLEEGQREAGGH 576

  Fly   658 WLDPFYLYPQ 667
            ..|||:..|:
plant   577 VWDPFFSKPK 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
botvNP_523790.1 TBPIP <107..185 CDD:284512
Exostosin 224..551 CDD:281069 57/248 (23%)
Glyco_transf_64 714..949 CDD:286358
MUR3NP_179627.2 Exostosin 150..489 CDD:397245 61/267 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.