DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment botv and si:dkey-13e3.1

DIOPT Version :9

Sequence 1:NP_523790.1 Gene:botv / 37198 FlyBaseID:FBgn0027535 Length:972 Species:Drosophila melanogaster
Sequence 2:NP_001106812.1 Gene:si:dkey-13e3.1 / 571594 ZFINID:ZDB-GENE-060503-805 Length:222 Species:Danio rerio


Alignment Length:151 Identity:26/151 - (17%)
Similarity:44/151 - (29%) Gaps:57/151 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   786 IETEAVLSVDDDAHLRHDEI----LFGFRVWREHRDRVVGFPGR--------YHAWDLG------ 832
            |....::.:.::|....:.|    |:....|:..:|.|..||..        ..||...      
Zfish    79 IGNACMILIYEEARAHGNNIYIADLYVVATWKSSKDPVAYFPNNADLMDALVLPAWIQATVSDHY 143

  Fly   833 -------NPNGQW------------HYNSNYSCELSMVLTGAAFVHKYYLYLYTYHLPQAIRDKV 878
                   || .||            ..|::..|.:.|::        |.||..           :
Zfish   144 VNIAQSLNP-AQWTEVTGLNIGVLPQQNNSNDCGIFMLM--------YALYTV-----------L 188

  Fly   879 DEYMNCEDIAMNFLVSHITRK 899
            |...|...:....|:.:|..|
Zfish   189 DIPFNFSQVVFYILLLYIFNK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
botvNP_523790.1 TBPIP <107..185 CDD:284512
Exostosin 224..551 CDD:281069
Glyco_transf_64 714..949 CDD:286358 26/151 (17%)
si:dkey-13e3.1NP_001106812.1 DUF819 <137..216 CDD:242981 15/93 (16%)
Peptidase_C48 <166..196 CDD:304959 8/48 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.