DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment botv and extl2

DIOPT Version :9

Sequence 1:NP_523790.1 Gene:botv / 37198 FlyBaseID:FBgn0027535 Length:972 Species:Drosophila melanogaster
Sequence 2:NP_001070029.1 Gene:extl2 / 558373 ZFINID:ZDB-GENE-060929-1122 Length:332 Species:Danio rerio


Alignment Length:264 Identity:84/264 - (31%)
Similarity:128/264 - (48%) Gaps:43/264 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   710 PREQFTIVMLTYEREQVLMDSLGRLYGLPYLHKVVVVWNSPKPPLDDLRWPDIG---VPVAVLRA 771
            |.|.|||:|.||.|..||:..|.....:|:|..:::|||:|........|.::|   |||.....
Zfish    62 PEESFTIIMQTYNRTDVLLRLLNHYQAVPHLQCIIIVWNNPGETPPRRLWDELGPHPVPVLFREQ 126

  Fly   772 PRNSLNNRFLPFDVIETEAVLSVDDDAHLRHDEILFGFRVWREHRDRVVGFPGRYHAWDLGNPNG 836
            ..|.:.||.:....::|:|||.:|||..|...:|.|.|.||::..|::|||..|.|   :.:.:|
Zfish   127 RVNRMRNRLMMHPDVKTDAVLMLDDDILLSVPDISFAFSVWKQFPDQIVGFVPRKH---VSSASG 188

  Fly   837 QWHYNSNYSCEL-----------SMVLTGAAFVHKYYLYLYTYHLPQAIRDKVDEYMNCEDIAMN 890
            .:.|.   |.||           ||:|.||:|.|:.:|..: ...|..:...:|...||:|||||
Zfish   189 VYSYG---SFELQDPDKGGGDRYSMILVGASFFHRRFLKQF-QEQPAEVHTLLDRTQNCDDIAMN 249

  Fly   891 FLVSHITRKPPVKVTSRWTFRCPGCPVSLS--EDDT------------HFQERHKCINFFSRVFG 941
            |:|:....|.|..|..:        ||.:|  |.|.            |..:|..|:|..::::|
Zfish   250 FIVARQLSKRPSGVFVK--------PVHMSNLEKDASSGFVGMWHRPEHMLQRSYCLNKLAQIYG 306

  Fly   942 YTPL 945
            :.||
Zfish   307 HMPL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
botvNP_523790.1 TBPIP <107..185 CDD:284512
Exostosin 224..551 CDD:281069
Glyco_transf_64 714..949 CDD:286358 82/260 (32%)
extl2NP_001070029.1 Glyco_transf_64 66..314 CDD:286358 82/260 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D314330at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.