DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment botv and extl2

DIOPT Version :9

Sequence 1:NP_523790.1 Gene:botv / 37198 FlyBaseID:FBgn0027535 Length:972 Species:Drosophila melanogaster
Sequence 2:XP_012816366.1 Gene:extl2 / 493327 XenbaseID:XB-GENE-1001404 Length:325 Species:Xenopus tropicalis


Alignment Length:297 Identity:91/297 - (30%)
Similarity:134/297 - (45%) Gaps:50/297 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   680 FMGSHTGFRPIGKGLGGAGKEFGESLGGNYPREQFTIVMLTYEREQVLMDSLGRLYGLPYLHKVV 744
            |:|:.|...|........|...|..|....|::.||::|.||.|..:|:..|.....:|.|..|:
 Frog    26 FLGALTALLPATNEDAVVGVRRGIPLSAVSPKDVFTLIMQTYNRTDLLLKMLNHYQAMPGLSHVI 90

  Fly   745 VVWNSPKPPLDDLRWPDIG---VPVAVLRAPRNSLNNRFLPFDVIETEAVLSVDDDAHLRHDEIL 806
            ||||:.........|...|   |||...:...|.:.||...|..|:|:|||.:|||..:...:|.
 Frog    91 VVWNNVGQDTPQELWESFGPHPVPVTFKKQKVNLMRNRLQSFPEIQTQAVLMMDDDTLVSAYDIS 155

  Fly   807 FGFRVWREHRDRVVGFPGRYHAWDLGNPNGQWHYNSNYSCEL-----------SMVLTGAAFVHK 860
            |.|.:|::..||:|||..|.|   :.:|:|.:.|.   |.||           ||:|.||||.|.
 Frog   156 FAFSIWQQFPDRIVGFVPRKH---VSSPSGIYSYG---SFELKAPHTETGDMYSMILIGAAFFHS 214

  Fly   861 YYLYLYTYHLPQAIRDKVDEYMNCEDIAMNFLV-SHITRKPPVKV----------------TSRW 908
            .||.|:. .||.::.:.:|:..||:||||||:| :|:.:...|.|                |..|
 Frog   215 DYLRLFE-QLPASVHNMIDQTQNCDDIAMNFMVANHLGKASGVLVKPTDMRNLEKEAGSGYTGMW 278

  Fly   909 TFRCPGCPVSLSEDDTHFQERHKCINFFSRVFGYTPL 945
                        ....|..:|..|:|..:.::...||
 Frog   279 ------------HRAEHLLQRSFCLNKLAEIYSTMPL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
botvNP_523790.1 TBPIP <107..185 CDD:284512
Exostosin 224..551 CDD:281069
Glyco_transf_64 714..949 CDD:286358 83/263 (32%)
extl2XP_012816366.1 Glyco_transf_64 60..311 CDD:401264 83/263 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D314330at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.