DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 5-HT1A and or92a7

DIOPT Version :9

Sequence 1:NP_001356890.1 Gene:5-HT1A / 37196 FlyBaseID:FBgn0004168 Length:846 Species:Drosophila melanogaster
Sequence 2:NP_001373206.1 Gene:or92a7 / 794363 ZFINID:ZDB-GENE-070806-21 Length:322 Species:Danio rerio


Alignment Length:112 Identity:27/112 - (24%)
Similarity:44/112 - (39%) Gaps:18/112 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   731 MQKVNKRKETLEAKRERKAAKTLAIITGAFVVCWLPFFVMALTMPLCAACQISDSVASLFLWLGY 795
            |..:..|..:.:....:||.||:.:......:|...|..:.:...|   ..::.|.:|||:.|.|
Zfish   214 MIMITARSVSSDKDSAKKALKTVMLHLIQLGLCLTSFLYVTIERTL---YMMTGSDSSLFINLRY 275

  Fly   796 FN--------STLNPVIYTIFSPEFRQAFKRILFGGHRPVHYRSGKL 834
            .|        ..|:|:||.:........||....       |||||:
Zfish   276 LNYIIVLILPRCLSPLIYGMRDEAVWPLFKYFFC-------YRSGKV 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
5-HT1ANP_001356890.1 7tmA_5-HT1A_invertebrates 227..>413 CDD:320454
TM helix 1 228..254 CDD:320454
TM helix 2 261..287 CDD:320454
TM helix 3 299..329 CDD:320454
TM helix 4 340..362 CDD:320454
TM helix 5 383..412 CDD:320454
7tm_GPCRs <743..816 CDD:355774 18/80 (23%)
TM helix 6 747..772 CDD:341315 6/24 (25%)
TM helix 7 784..809 CDD:341315 11/32 (34%)
or92a7NP_001373206.1 7tm_1 61..293 CDD:394960 18/81 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.