DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 5-HT1A and or90h4

DIOPT Version :9

Sequence 1:NP_001356890.1 Gene:5-HT1A / 37196 FlyBaseID:FBgn0004168 Length:846 Species:Drosophila melanogaster
Sequence 2:NP_001129719.1 Gene:or90h4 / 556415 ZFINID:ZDB-GENE-070806-23 Length:315 Species:Danio rerio


Alignment Length:275 Identity:52/275 - (18%)
Similarity:109/275 - (39%) Gaps:73/275 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 LNVTTSKVAEDDFTQLLRMAVTSVLLGLMILVTIIGNVFVI---AAIILERNLQNVANYLVASLA 269
            :|.|...|  |::.:.:...:..|.|.|  :|.:|..:.|:   ::.:..|:.:.:   |...|.
Zfish    11 MNTTVWIV--DNYQEAITKHIVIVFLAL--IVNVINGMLVVTFFSSHVFSRDSRYI---LYIHLV 68

  Fly   270 VADLFVACLVMPLGAVYEISQ-GWILGPELCDIWTSCDVLCCTASILHLVAIAVDRYWAVTNIDY 333
            :.|:.:.|..:   |:|.::. ..::...||.|..|...:....:.|:|..:|::|:.||.. ..
Zfish    69 INDMLMICASV---AIYVLTYIAPVVNASLCYILMSLGKVFFMITPLNLAGMAIERFIAVCK-PL 129

  Fly   334 IHSR--TSNRVFMMIFCVWTAAVIVSLAPQFGWKDPDYLQRIEQQKCMVSQDVS-YQVFATCC-T 394
            .||:  |..|.::....:|..|.|.|:              ::....:::|.:| ::.|..|. |
Zfish   130 HHSQICTPQRTYVFFCLLWGIAAIRSV--------------VDIMISLLTQPISFFRSFVPCYPT 180

  Fly   395 FYVP-------------------LLVILALYWKIYQTARKRIHRRRPRPVDAAVNNNQPDGGAAT 440
            :..|                   .::|...|.::...|||.:.:                 |:|:
Zfish   181 YMFPSKAHDDHNTASQVICMSMVWIIICYTYCRVLFAARKAVSK-----------------GSAS 228

  Fly   441 DTK----LHRLRLRL 451
            ..:    ||.::|.|
Zfish   229 KARSTILLHGVQLLL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
5-HT1ANP_001356890.1 7tmA_5-HT1A_invertebrates 227..>413 CDD:320454 39/212 (18%)
TM helix 1 228..254 CDD:320454 6/28 (21%)
TM helix 2 261..287 CDD:320454 5/25 (20%)
TM helix 3 299..329 CDD:320454 8/29 (28%)
TM helix 4 340..362 CDD:320454 5/21 (24%)
TM helix 5 383..412 CDD:320454 7/49 (14%)
7tm_GPCRs <743..816 CDD:355774
TM helix 6 747..772 CDD:341315
TM helix 7 784..809 CDD:341315
or90h4NP_001129719.1 7tm_4 32..>161 CDD:304433 31/151 (21%)
7tm_1 42..288 CDD:278431 43/240 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.