| Sequence 1: | NP_001356890.1 | Gene: | 5-HT1A / 37196 | FlyBaseID: | FBgn0004168 | Length: | 846 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_001923211.1 | Gene: | or137-5 / 100149850 | ZFINID: | ZDB-GENE-070806-26 | Length: | 310 | Species: | Danio rerio |
| Alignment Length: | 247 | Identity: | 53/247 - (21%) |
|---|---|---|---|
| Similarity: | 85/247 - (34%) | Gaps: | 74/247 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 208 LNVTTSKV-AEDDFTQLLRMAVTSVLLGLMILVTIIGNVFVIAAIILERNLQNVANY-LVASLAV 270
Fly 271 ADLFVACLVMPLGAVYEISQGWILGPELCDIWTSCDVLCCTA------SILHLVAIAVDRYWAVT 329
Fly 330 NIDYIHS-RTSNRVFMMIFCVWTAAVIVSLA---------PQFGWKDPDYLQRIEQQKCMVSQDV 384
Fly 385 SYQVFATCCT----FYVPL-----------------LVILALYWKIYQTARK 415 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| 5-HT1A | NP_001356890.1 | 7tmA_5-HT1A_invertebrates | 227..>413 | CDD:320454 | 42/223 (19%) |
| TM helix 1 | 228..254 | CDD:320454 | 6/25 (24%) | ||
| TM helix 2 | 261..287 | CDD:320454 | 5/26 (19%) | ||
| TM helix 3 | 299..329 | CDD:320454 | 11/35 (31%) | ||
| TM helix 4 | 340..362 | CDD:320454 | 6/30 (20%) | ||
| TM helix 5 | 383..412 | CDD:320454 | 6/49 (12%) | ||
| 7tm_GPCRs | <743..816 | CDD:355774 | |||
| TM helix 6 | 747..772 | CDD:341315 | |||
| TM helix 7 | 784..809 | CDD:341315 | |||
| or137-5 | XP_001923211.1 | 7tm_4 | 22..>147 | CDD:304433 | 31/135 (23%) |
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24247 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||