DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15116 and GPX1

DIOPT Version :9

Sequence 1:NP_611393.2 Gene:CG15116 / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_012899.3 Gene:GPX1 / 853842 SGDID:S000001509 Length:167 Species:Saccharomyces cerevisiae


Alignment Length:153 Identity:59/153 - (38%)
Similarity:79/153 - (51%) Gaps:8/153 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DTFGNPVQLDTFAGHVLLIVNIASKCGLTLSQYNGLRYLLEEYEDQGLRILNFPCNQFGGQMPES 111
            |..|||...::....|:||||:||.|..| .||..|.||.|:|:..||.|:.|||.|||.|..|.
Yeast    11 DENGNPFPFNSLRNKVVLIVNVASHCAFT-PQYKELEYLYEKYKSHGLVIVAFPCGQFGNQEFEK 74

  Fly   112 DGQEMLDHLRREGANIGHLFAKIDVKGAQADPLYKLLTRHQHD------IEWNFVKFLVDRKGNI 170
            | :|:....:.:......:..||...|.:.||:||.|......      |:|||.||:|||.|.:
Yeast    75 D-KEINKFCQDKYGVTFPILHKIRCNGQKQDPVYKFLKNSVSGKSGIKMIKWNFEKFVVDRNGKV 138

  Fly   171 HKRYGAELEPVALTDDIELLLGR 193
            .||:.....|:.|...||.||.:
Yeast   139 VKRFSCMTRPLELCPIIEELLNQ 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15116NP_611393.2 GSH_Peroxidase 39..187 CDD:238207 55/145 (38%)
GPX1NP_012899.3 BtuE 1..161 CDD:223463 59/151 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343579
Domainoid 1 1.000 95 1.000 Domainoid score I1660
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I1206
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 1 1.000 - - mtm9228
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X276
TreeFam 00.000 Not matched by this tool.
98.690

Return to query results.
Submit another query.