DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15116 and GPX7

DIOPT Version :9

Sequence 1:NP_611393.2 Gene:CG15116 / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_194915.2 Gene:GPX7 / 829316 AraportID:AT4G31870 Length:233 Species:Arabidopsis thaliana


Alignment Length:158 Identity:72/158 - (45%)
Similarity:93/158 - (58%) Gaps:6/158 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 TIHALTVRDTFGNPVQLDTFAGHVLLIVNIASKCGLTLSQYNGLRYLLEEYEDQGLRILNFPCNQ 103
            ::|..||:|..||.|.||.|.|..|||||:||:||||.|.|:.|..|.|:|::||..||.|||||
plant    75 SVHDFTVKDIDGNDVSLDKFKGKPLLIVNVASRCGLTSSNYSELSQLYEKYKNQGFEILAFPCNQ 139

  Fly   104 FGGQMPESDGQEMLDHLRREGANIGHLFAKIDVKGAQADPLYKLLTRHQHD-----IEWNFVKFL 163
            ||||.|.|:.:.......|..|.. .:|.|:||.|....|:||.|..:...     |:|||.|||
plant   140 FGGQEPGSNPEIKQFACTRFKAEF-PIFDKVDVNGPSTAPIYKFLKSNAGGFLGDIIKWNFEKFL 203

  Fly   164 VDRKGNIHKRYGAELEPVALTDDIELLL 191
            ||:||.:.:||.....|..:..||:.||
plant   204 VDKKGKVVERYPPTTSPFQIEKDIQKLL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15116NP_611393.2 GSH_Peroxidase 39..187 CDD:238207 68/152 (45%)
GPX7NP_194915.2 PLN02399 1..233 CDD:178021 72/158 (46%)
AhpC-TSA 78..213 CDD:278975 64/135 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X276
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.680

Return to query results.
Submit another query.