DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15116 and GPX5

DIOPT Version :9

Sequence 1:NP_611393.2 Gene:CG15116 / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_191867.1 Gene:GPX5 / 825483 AraportID:AT3G63080 Length:173 Species:Arabidopsis thaliana


Alignment Length:163 Identity:66/163 - (40%)
Similarity:88/163 - (53%) Gaps:12/163 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 TIHALTVRDTFGNPVQLDTFAGHVLLIVNIASKCGLTLSQYNGLRYLLEEYEDQGLRILNFPCNQ 103
            :||..||:|:.|..|.|..:.|.|||:||:|||||.|.|.|..|..|..:|:|||..:|.|||||
plant    13 SIHQFTVKDSSGKEVDLSVYQGKVLLVVNVASKCGFTESNYTQLTELYRKYKDQGFVVLAFPCNQ 77

  Fly   104 FGGQMP---ESDGQEMLDHLRREGANIGHLFAKIDVKGAQADPLYKLLTRHQHD-----IEWNFV 160
            |..|.|   |...|......:.|..    :|.|:.|.|..|.|:||.|...:..     |:|||.
plant    78 FLSQEPGTSEEAHQFACTRFKAEYP----VFQKVRVNGQNAAPVYKFLKSKKPSFLGSRIKWNFT 138

  Fly   161 KFLVDRKGNIHKRYGAELEPVALTDDIELLLGR 193
            ||||.:.|.:..|||..:.|:::..|||..|.:
plant   139 KFLVGKDGQVIDRYGTTVSPLSIQKDIEKALAQ 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15116NP_611393.2 GSH_Peroxidase 39..187 CDD:238207 62/155 (40%)
GPX5NP_191867.1 GSH_Peroxidase 14..165 CDD:238207 62/154 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.680

Return to query results.
Submit another query.