DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15116 and GPX3

DIOPT Version :9

Sequence 1:NP_611393.2 Gene:CG15116 / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001189742.1 Gene:GPX3 / 818936 AraportID:AT2G43350 Length:206 Species:Arabidopsis thaliana


Alignment Length:201 Identity:77/201 - (38%)
Similarity:104/201 - (51%) Gaps:27/201 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KEFLFPGLLVAVALVVVL----QTRSRLQQDLQDMRWRLTIHALTVRDTFGNPVQLDTFAGHVLL 64
            |:|:   |.:.||.|..|    .:.|.::|.      ..:|:.::|:|..|..|.|..|.|.|||
plant    17 KKFI---LFLGVAFVFYLYRYPSSPSTVEQS------STSIYNISVKDIEGKDVSLSKFTGKVLL 72

  Fly    65 IVNIASKCGLTLSQYNGLRYLLEEYEDQGLRILNFPCNQFGGQMPESDGQEMLDHLRREGANIGH 129
            |||:|||||||...|..:..|..:|:.||..||.|||||||.|.|.|:.:     ::....||..
plant    73 IVNVASKCGLTHGNYKEMNILYAKYKTQGFEILAFPCNQFGSQEPGSNME-----IKETVCNIFK 132

  Fly   130 ----LFAKIDVKGAQADPLYKLLTRHQ-----HDIEWNFVKFLVDRKGNIHKRYGAELEPVALTD 185
                :|.||:|.|....|||..|...:     ..|:|||.||||||:||:..||.....|:.:..
plant   133 AEFPIFDKIEVNGKNTCPLYNFLKEQKGGLFGDAIKWNFAKFLVDRQGNVVDRYAPTTSPLEIEK 197

  Fly   186 DIELLL 191
            ||..||
plant   198 DIVKLL 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15116NP_611393.2 GSH_Peroxidase 39..187 CDD:238207 64/156 (41%)
GPX3NP_001189742.1 Thioredoxin_like 42..206 CDD:412351 69/173 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.680

Return to query results.
Submit another query.