DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15116 and GPX1

DIOPT Version :9

Sequence 1:NP_611393.2 Gene:CG15116 / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_180080.1 Gene:GPX1 / 817046 AraportID:AT2G25080 Length:236 Species:Arabidopsis thaliana


Alignment Length:158 Identity:68/158 - (43%)
Similarity:92/158 - (58%) Gaps:6/158 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 TIHALTVRDTFGNPVQLDTFAGHVLLIVNIASKCGLTLSQYNGLRYLLEEYEDQGLRILNFPCNQ 103
            |:|..||:|..|..|.|:.|.|.|:||||:||:||||.|.|:.|.:|.|:|:.||..||.|||||
plant    78 TVHDFTVKDIDGKDVALNKFKGKVMLIVNVASRCGLTSSNYSELSHLYEKYKTQGFEILAFPCNQ 142

  Fly   104 FGGQMPESDGQEMLDHLRREGANIGHLFAKIDVKGAQADPLYKLLTRHQHD-----IEWNFVKFL 163
            ||.|.|.|:.:.......|..|.. .:|.|:||.|....|:|:.|..:...     |:|||.|||
plant   143 FGFQEPGSNSEIKQFACTRFKAEF-PIFDKVDVNGPSTAPIYEFLKSNAGGFLGGLIKWNFEKFL 206

  Fly   164 VDRKGNIHKRYGAELEPVALTDDIELLL 191
            :|:||.:.:||.....|..:..||:.||
plant   207 IDKKGKVVERYPPTTSPFQIEKDIQKLL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15116NP_611393.2 GSH_Peroxidase 39..187 CDD:238207 64/152 (42%)
GPX1NP_180080.1 PLN02399 1..236 CDD:178021 68/158 (43%)
AhpC-TSA 81..216 CDD:278975 59/135 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X276
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.680

Return to query results.
Submit another query.