DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15116 and gpx3

DIOPT Version :9

Sequence 1:NP_611393.2 Gene:CG15116 / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001131027.1 Gene:gpx3 / 798788 ZFINID:ZDB-GENE-070222-3 Length:222 Species:Danio rerio


Alignment Length:137 Identity:49/137 - (35%)
Similarity:64/137 - (46%) Gaps:28/137 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 FAGHVLLIVNIASKCGLTLSQYNGLRYLLEEYEDQGLRILNFPCNQFGGQMPESDGQEMLDHLRR 122
            :||..:|:||:|:..|||. ||..|..|.||....|..||.|||:|||.|.| .:..|:|..|:.
Zfish    57 YAGKHVLVVNVATYUGLTF-QYVELNALHEELRHLGFTILGFPCDQFGKQEP-GENNEILSALKY 119

  Fly   123 EGANIG-----HLFAKIDVKGAQADPLYKLL-------------TRHQ--------HDIEWNFVK 161
            .....|     .||.|.||.|.....|:..|             |.::        :||:|||.|
Zfish   120 VRPGNGFVPNFQLFEKGDVNGDGEQALFTFLKNACPPVGESFGATSNRLFWEPLKVNDIKWNFEK 184

  Fly   162 FLVDRKG 168
            ||:|..|
Zfish   185 FLLDPDG 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15116NP_611393.2 GSH_Peroxidase 39..187 CDD:238207 49/137 (36%)
gpx3NP_001131027.1 GSH_Peroxidase 37..210 CDD:238207 49/137 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.