DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15116 and gpx9

DIOPT Version :9

Sequence 1:NP_611393.2 Gene:CG15116 / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001341101.1 Gene:gpx9 / 794084 ZFINID:ZDB-GENE-130603-13 Length:140 Species:Danio rerio


Alignment Length:138 Identity:43/138 - (31%)
Similarity:62/138 - (44%) Gaps:33/138 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LLEEYEDQGLRILNFPCNQFGGQMPESDGQ--EMLDHLRREGANIGH--LFAKIDVKGAQADPLY 145
            |::.|..|...:|.|||||||.|.||.:.:  .:|.|:|.....:..  :|::|:|.|:..||||
Zfish     4 LMDMYGGQRFTVLGFPCNQFGLQSPEENHETLNVLQHVRPGSGFLPKFPIFSRIEVNGSDEDPLY 68

  Fly   146 KLLTR--------------------HQHDIEWNFVKFLVDRKGNIHKRYGAELEPVALTDDIE-- 188
            ..|..                    ..:|:.|||.|||:...|..:|||.....    .:|:|  
Zfish    69 AYLKESLPFVNPVIGDIRKLYWSPIKANDVRWNFEKFLITADGRPYKRYDRNCP----FEDVERD 129

  Fly   189 ---LLLGR 193
               ||.||
Zfish   130 VSALLQGR 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15116NP_611393.2 GSH_Peroxidase 39..187 CDD:238207 37/125 (30%)
gpx9NP_001341101.1 Thioredoxin_like <1..130 CDD:320948 39/129 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48732
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.