DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15116 and gpx7

DIOPT Version :9

Sequence 1:NP_611393.2 Gene:CG15116 / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001072404.1 Gene:gpx7 / 779858 XenbaseID:XB-GENE-940915 Length:184 Species:Xenopus tropicalis


Alignment Length:171 Identity:58/171 - (33%)
Similarity:87/171 - (50%) Gaps:14/171 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ALVVVLQTRSRLQQDLQDMRWRLTIHALTVRDTFGNPVQLDTFAGHVLLIVNIASKCGLTLSQYN 80
            |||::|    .|...||..|...|...:.:|   |..|.|:.:.|.|.|:||:||:||.|.|.|.
 Frog     5 ALVLLL----LLPPSLQKSRDFYTFKVVNIR---GKLVSLEKYRGSVTLVVNVASECGFTDSHYK 62

  Fly    81 GLRYLLEEYEDQGLRILNFPCNQFGGQMPESDGQEMLDHLRREGANIGHLFAKIDVKGAQADPLY 145
            .|:.|..:.......:|.|||||||.|.|.|| :|:.:.:|:..:....:|:|..|.|...:..:
 Frog    63 ALQQLQRDLGSYHFNVLAFPCNQFGQQEPNSD-REIENFVRKNYSASFPMFSKTAVTGTGVNSAF 126

  Fly   146 K-LLTRHQHDIEWNFVKFLVDRKGNIHKRYG-----AELEP 180
            | |:.....:.:|||.|:||...|.:...:|     ||:.|
 Frog   127 KYLIESSGKEPDWNFWKYLVGPDGKVVDAWGPSVSVAEVRP 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15116NP_611393.2 GSH_Peroxidase 39..187 CDD:238207 50/148 (34%)
gpx7NP_001072404.1 Thioredoxin_like 21..173 CDD:320948 50/151 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8051
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4852
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 1 1.000 - - mtm9500
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.