DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15116 and Gpx7

DIOPT Version :9

Sequence 1:NP_611393.2 Gene:CG15116 / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_077160.1 Gene:Gpx7 / 67305 MGIID:1914555 Length:186 Species:Mus musculus


Alignment Length:192 Identity:62/192 - (32%)
Similarity:101/192 - (52%) Gaps:20/192 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLVAVA---LVVVLQTRSRLQQDLQDMRWRLTIHALTVRDTFGNPVQLDTFAGHVLLIVNIASKC 72
            ::.|||   |::.....::.:||..|.:      |:.:|   |..|.|:.:.|.|.|:||:||:|
Mouse     1 MVAAVATAWLLLWAAACAQSEQDFYDFK------AVNIR---GKLVSLEKYRGSVSLVVNVASEC 56

  Fly    73 GLTLSQYNGLRYLLEEYEDQGLRILNFPCNQFGGQMPESDGQEMLDHLRREGANIGHLFAKIDVK 137
            |.|...|..|:.|..:.......:|.|||||||.|.|::: :|:.:..||..:....:|:||.|.
Mouse    57 GFTDQNYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDTN-REIENFARRTYSVSFPMFSKIAVT 120

  Fly   138 GAQADPLYKLLTRHQ-HDIEWNFVKFLVDRKGNIHKRYG-----AELEPVALTDDIELLLGR 193
            |..|.|.:|.||:.. .:..|||.|:|||..|.:...:.     ||::| .:|:.:..|:.|
Mouse   121 GTGAHPAFKYLTQTSGKEPTWNFWKYLVDPDGKVVGAWDPTVPVAEIKP-RITEQVMKLILR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15116NP_611393.2 GSH_Peroxidase 39..187 CDD:238207 53/153 (35%)
Gpx7NP_077160.1 gpx7 23..175 CDD:131592 55/162 (34%)
AhpC-TSA 26..155 CDD:278975 50/138 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 93 1.000 Domainoid score I7531
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.670

Return to query results.
Submit another query.