DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15116 and Gpx3

DIOPT Version :9

Sequence 1:NP_611393.2 Gene:CG15116 / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_071970.2 Gene:Gpx3 / 64317 RGDID:69224 Length:226 Species:Rattus norvegicus


Alignment Length:136 Identity:53/136 - (38%)
Similarity:60/136 - (44%) Gaps:27/136 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 FAGHVLLIVNIASKCGLTLSQYNGLRYLLEEYEDQGLRILNFPCNQFGGQMPESDGQEMLDHLR- 121
            :||..:|.||:||..||| .||..|..|.||....||.||.|||||||.|.| .:..|:|..|: 
  Rat    59 YAGKYILFVNVASYUGLT-DQYLELNALQEELGPFGLVILGFPCNQFGKQEP-GENSEILPSLKY 121

  Fly   122 -REGANI---GHLFAKIDVKGAQADPLYKLLTR--------------------HQHDIEWNFVKF 162
             |.|...   ..||.|.||.|.:....|..|..                    ..|||.|||.||
  Rat   122 VRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTAELLGSPGRLFWEPMKIHDIRWNFEKF 186

  Fly   163 LVDRKG 168
            ||...|
  Rat   187 LVGPDG 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15116NP_611393.2 GSH_Peroxidase 39..187 CDD:238207 53/136 (39%)
Gpx3NP_071970.2 GSH_Peroxidase 39..211 CDD:238207 53/136 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.