DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15116 and gpx7

DIOPT Version :9

Sequence 1:NP_611393.2 Gene:CG15116 / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001018337.1 Gene:gpx7 / 552981 ZFINID:ZDB-GENE-050522-419 Length:186 Species:Danio rerio


Alignment Length:168 Identity:56/168 - (33%)
Similarity:86/168 - (51%) Gaps:11/168 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVAVALVVVLQTRSRLQQDLQDMRWRLTIHALTVRDTFGNPVQLDTFAGHVLLIVNIASKCGLTL 76
            |.|..|:::|......|:|         .:...|.::.|..|.|:.:.|.|.|.||:||:||.|.
Zfish     5 LRAFTLIILLCLLEAKQKD---------FYTFKVVNSRGRLVSLEKYRGSVSLAVNVASECGYTD 60

  Fly    77 SQYNGLRYLLEEYEDQGLRILNFPCNQFGGQMPESDGQEMLDHLRREGANIGHLFAKIDVKGAQA 141
            ..|..|:.|.:::......:|.|||||||.|.|.|| :|:...:||.......:|:||.|.|..|
Zfish    61 EHYKDLQQLQKDFGPFHFNVLAFPCNQFGQQEPGSD-KEIDSFVRRVYGVSFPIFSKIAVVGIGA 124

  Fly   142 DPLYK-LLTRHQHDIEWNFVKFLVDRKGNIHKRYGAEL 178
            :..|| |:...:.:..|||.|:|:|..|.:...:|.|:
Zfish   125 NNAYKYLVEASRKEPTWNFWKYLIDTDGKVVDAWGPEV 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15116NP_611393.2 GSH_Peroxidase 39..187 CDD:238207 50/141 (35%)
gpx7NP_001018337.1 Thioredoxin_like 23..175 CDD:294274 51/150 (34%)
AhpC-TSA 27..157 CDD:278975 48/130 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.680

Return to query results.
Submit another query.