DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15116 and GPX8

DIOPT Version :9

Sequence 1:NP_611393.2 Gene:CG15116 / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:XP_006714694.1 Gene:GPX8 / 493869 HGNCID:33100 Length:210 Species:Homo sapiens


Alignment Length:182 Identity:59/182 - (32%)
Similarity:98/182 - (53%) Gaps:6/182 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AVALVVVLQTRSRLQQDLQDMRWRL-TIHALTVRDTFGNPVQLDTFAG-HVLLIVNIASKCGLTL 76
            ||.|.:||.|.:.....|:.::.:: :.:|..|:|..|..|.|:.:.| .|.|:||:||.|.||.
Human    20 AVLLSIVLCTVTLFLLQLKFLKPKINSFYAFEVKDAKGRTVSLEKYKGKEVSLVVNVASDCQLTD 84

  Fly    77 SQYNGLRYLLEEYEDQGLRILNFPCNQFGGQMPESDGQEMLDHLRREGANIGHLFAKIDVKGAQA 141
            ..|.||:.|.:|:......:|.|||||||...|. ..:|:....|:.......:|.||.:.|::.
Human    85 RNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPR-PSKEVESFARKNYGVTFPIFHKIKILGSEG 148

  Fly   142 DPLYK-LLTRHQHDIEWNFVKFLVDRKGNIHKRYGAELEPV-ALTDDIELLL 191
            :|.:: |:...:.:..|||.|:||:.:|.:.|.:..| ||: .:..||..|:
Human   149 EPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWKPE-EPIEVIRPDIAALV 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15116NP_611393.2 GSH_Peroxidase 39..187 CDD:238207 49/150 (33%)
GPX8XP_006714694.1 gpx7 46..199 CDD:131592 51/154 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.680

Return to query results.
Submit another query.