DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15116 and gpx4a

DIOPT Version :9

Sequence 1:NP_611393.2 Gene:CG15116 / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001333466.1 Gene:gpx4a / 352928 ZFINID:ZDB-GENE-030410-2 Length:194 Species:Danio rerio


Alignment Length:197 Identity:66/197 - (33%)
Similarity:100/197 - (50%) Gaps:15/197 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FDKEFLFPGLLVAVALVVVLQTRSRLQQDLQDMRWRLTIHALTVRDTFGNPVQLDTFAGHVLLIV 66
            |...||..|.|.:..::      ......|:|.:...:|:..|..|..||.|.|:.:.|.|::|.
Zfish     6 FIHRFLLFGALSSSGII------GATSAQLEDWQTAKSIYEFTATDIDGNEVSLEKYRGKVVIIT 64

  Fly    67 NIASKCGLTLSQYNGLRYLLEEYEDQGLRILNFPCNQFGGQMPESDGQEMLDHLRREGANIGHLF 131
            |:||| |.|...|:....:..:|.::|||||.||.||||.|.|.::.| :.:..:...|.. .:|
Zfish    65 NVASKUGKTPVNYSQFAEMHAKYSERGLRILAFPSNQFGRQEPGTNSQ-IKEFAKSYNAEF-DMF 127

  Fly   132 AKIDVKGAQADPLYKLLTRHQ-------HDIEWNFVKFLVDRKGNIHKRYGAELEPVALTDDIEL 189
            :||||.|..|.||:|.|....       :.|:|||.|||::|:|.:.|||....:|..:..|:..
Zfish   128 SKIDVNGDGAHPLWKWLKDQPNGKGFLGNGIKWNFTKFLINREGQVVKRYSPLQDPSVVEKDLSK 192

  Fly   190 LL 191
            .|
Zfish   193 YL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15116NP_611393.2 GSH_Peroxidase 39..187 CDD:238207 57/154 (37%)
gpx4aNP_001333466.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I6025
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48732
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.