DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15116 and Gpx4

DIOPT Version :9

Sequence 1:NP_611393.2 Gene:CG15116 / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001034938.1 Gene:Gpx4 / 29328 RGDID:69226 Length:253 Species:Rattus norvegicus


Alignment Length:167 Identity:63/167 - (37%)
Similarity:89/167 - (53%) Gaps:11/167 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DMRWRLTIHALTVRDTFGNPVQLDTFAGHVLLIVNIASKCGLTLSQYNGLRYLLEEYEDQGLRIL 97
            |.|...::|....:|..|:.|.||.:.|.|.::.|:||: |.|...|..|..|...|.:.|||||
  Rat    90 DWRCARSMHEFAAKDIDGHMVCLDKYRGCVCIVTNVASQUGKTDVNYTQLVDLHARYAECGLRIL 154

  Fly    98 NFPCNQFGGQMPESDGQEMLDHLRREGANIG-HLFAKIDVKGAQADPLYKLLTRHQ-------HD 154
            .|||||||.|.|.|: ||:.:.  ..|.|:. .:::||.|.|..|.||:|.:....       :.
  Rat   155 AFPCNQFGRQEPGSN-QEIKEF--AAGYNVRFDMYSKICVNGDDAHPLWKWMKVQPKGRGMLGNA 216

  Fly   155 IEWNFVKFLVDRKGNIHKRYGAELEPVALTDDIELLL 191
            |:|||.|||:|:.|.:.||||...||..:..|:...|
  Rat   217 IKWNFTKFLIDKNGCVVKRYGPMEEPQVIEKDLPCYL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15116NP_611393.2 GSH_Peroxidase 39..187 CDD:238207 59/155 (38%)
Gpx4NP_001034938.1 GSH_Peroxidase 96..249 CDD:238207 59/155 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 93 1.000 Domainoid score I7354
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4401
OMA 1 1.010 - - QHG48732
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 1 1.000 - - otm45351
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.