DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpxl and GPX7

DIOPT Version :10

Sequence 1:NP_611393.2 Gene:Gpxl / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_056511.2 Gene:GPX7 / 2882 HGNCID:4559 Length:187 Species:Homo sapiens


Alignment Length:144 Identity:51/144 - (35%)
Similarity:75/144 - (52%) Gaps:11/144 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QQDLQDMRWRLTIHALTVRDTFGNPVQLDTFAGHVLLIVNIASKCGLTLSQYNGLRYLLEEYEDQ 92
            :||..|.:      |:.:|   |..|.|:.:.|.|.|:||:||:||.|...|..|:.|..:....
Human    22 EQDFYDFK------AVNIR---GKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPH 77

  Fly    93 GLRILNFPCNQFGGQMPESDGQEMLDHLRREGANIGHLFAKIDVKGAQADPLYKLLTRHQ-HDIE 156
            ...:|.|||||||.|.|:|: :|:....||..:....:|:||.|.|..|.|.:|.|.:.. .:..
Human    78 HFNVLAFPCNQFGQQEPDSN-KEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPT 141

  Fly   157 WNFVKFLVDRKGNI 170
            |||.|:||...|.:
Human   142 WNFWKYLVAPDGKV 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GpxlNP_611393.2 GSH_Peroxidase 39..187 CDD:238207 48/133 (36%)
GPX7NP_056511.2 gpx7 24..176 CDD:131592 50/142 (35%)

Return to query results.
Submit another query.