DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15116 and GPX4

DIOPT Version :9

Sequence 1:NP_611393.2 Gene:CG15116 / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001034937.1 Gene:GPX4 / 2879 HGNCID:4556 Length:234 Species:Homo sapiens


Alignment Length:163 Identity:62/163 - (38%)
Similarity:90/163 - (55%) Gaps:11/163 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DMRWRLTIHALTVRDTFGNPVQLDTFAGHVLLIVNIASKCGLTLSQYNGLRYLLEEYEDQGLRIL 97
            |.|...::|..:.:|..|:.|.||.:.|.|.::.|:||: |.|...|..|..|...|.:.|||||
Human    71 DWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRIL 135

  Fly    98 NFPCNQFGGQMPESDGQEMLDHLRREGANIG-HLFAKIDVKGAQADPLYKLLTRHQ-------HD 154
            .|||||||.|.|.|: :|:.:.  ..|.|:. .:|:||.|.|..|.||:|.:....       :.
Human   136 AFPCNQFGKQEPGSN-EEIKEF--AAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNA 197

  Fly   155 IEWNFVKFLVDRKGNIHKRYGAELEPVALTDDI 187
            |:|||.|||:|:.|.:.||||...||:.:..|:
Human   198 IKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15116NP_611393.2 GSH_Peroxidase 39..187 CDD:238207 59/155 (38%)
GPX4NP_001034937.1 GSH_Peroxidase 77..230 CDD:238207 59/155 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7330
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48732
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 1 1.000 - - otm41216
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X276
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.730

Return to query results.
Submit another query.