DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15116 and GPX2

DIOPT Version :9

Sequence 1:NP_611393.2 Gene:CG15116 / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_002074.2 Gene:GPX2 / 2877 HGNCID:4554 Length:190 Species:Homo sapiens


Alignment Length:171 Identity:50/171 - (29%)
Similarity:73/171 - (42%) Gaps:31/171 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GNPVQLDTFAGHVLLIVNIASKCGLTLSQYNGLRYLLEEYEDQGLRILNFPCNQFGGQMPESDGQ 114
            |..|..:||.|..:||.|:||..|.|...:..|..|...: .:.|.:|.|||||||.| .....:
Human    18 GEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRF-PRRLVVLGFPCNQFGHQ-ENCQNE 80

  Fly   115 EMLDHLR--REGANIGHLFA---KIDVKGAQADPL---------------YKLLTR--------- 150
            |:|:.|:  |.|......|.   |.:|.|....|:               :.|:|.         
Human    81 EILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPV 145

  Fly   151 HQHDIEWNFVKFLVDRKGNIHKRYGAELEPVALTDDIELLL 191
            .:.|:.|||.|||:..:|...:||......:.:..||:.||
Human   146 RRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15116NP_611393.2 GSH_Peroxidase 39..187 CDD:238207 46/165 (28%)
GPX2NP_002074.2 GSH_Peroxidase 7..182 CDD:238207 46/165 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48732
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.