DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpxl and Gpx6

DIOPT Version :10

Sequence 1:NP_611393.2 Gene:Gpxl / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_671694.1 Gene:Gpx6 / 259233 RGDID:628789 Length:221 Species:Rattus norvegicus


Alignment Length:143 Identity:52/143 - (36%)
Similarity:68/143 - (47%) Gaps:25/143 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GNPVQLDTFAGHVLLIVNIASKCGLTLSQYNGLRYLLEEYEDQGLRILNFPCNQFGGQMPESDGQ 114
            |..||...:||..:|.||:||.|||| :.|..|..|.||.....:.:|.|||||||.|.|..:.:
  Rat    51 GEYVQFQQYAGKHILFVNVASFCGLT-ATYPELNTLQEELRPFNVSVLGFPCNQFGKQEPGKNSE 114

  Fly   115 EM--LDHLRREGANIGH--LFAKIDVKG-----------AQADPLYKLLTRHQ---------HDI 155
            .:  |.::|..|..:.:  ||.|.||.|           :...|..:||...:         |||
  Rat   115 ILLGLKYVRPGGGFVPNFQLFEKGDVNGDNEQKVFSFLKSSCPPTSELLGSPEHLFWDPMKVHDI 179

  Fly   156 EWNFVKFLVDRKG 168
            .|||.||||...|
  Rat   180 RWNFEKFLVGPDG 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GpxlNP_611393.2 GSH_Peroxidase 39..187 CDD:238207 52/143 (36%)
Gpx6NP_671694.1 GSH_Peroxidase 39..211 CDD:238207 52/143 (36%)

Return to query results.
Submit another query.