DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15116 and gpx1

DIOPT Version :9

Sequence 1:NP_611393.2 Gene:CG15116 / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_596146.1 Gene:gpx1 / 2540222 PomBaseID:SPBC32F12.03c Length:158 Species:Schizosaccharomyces pombe


Alignment Length:157 Identity:68/157 - (43%)
Similarity:92/157 - (58%) Gaps:13/157 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LTVRDTFGNPVQLDTFAGHVLLIVNIASKCGLTLSQYNGLRYLLEEYEDQGLRILNFPCNQFGGQ 107
            |..:|..|||.......|.|:|:||.|||||.| .||.||..|.::|:|:|..||.|||||||.|
pombe     7 LAPKDKDGNPFPFSNLKGKVVLVVNTASKCGFT-PQYKGLEALYQKYKDRGFIILGFPCNQFGNQ 70

  Fly   108 MPESDGQEMLDHLRREGANIGHLF---AKIDVKGAQADPLYKLLTRHQHD-----IEWNFVKFLV 164
            .|.|| :|:....::   |.|..|   |||:|.|...||:|:.|...:..     |:|||.||||
pombe    71 EPGSD-EEIAQFCQK---NYGVTFPVLAKINVNGDNVDPVYQFLKSQKKQLGLERIKWNFEKFLV 131

  Fly   165 DRKGNIHKRYGAELEPVALTDDIELLL 191
            :|:|.:.:||.:..:|..|.:|||.:|
pombe   132 NRQGQVIERYSSISKPEHLENDIESVL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15116NP_611393.2 GSH_Peroxidase 39..187 CDD:238207 64/151 (42%)
gpx1NP_596146.1 BtuE 1..158 CDD:223463 67/155 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 98 1.000 Domainoid score I1869
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I1411
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 1 1.000 - - otm47225
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X276
TreeFam 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.