DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15116 and Gpx1

DIOPT Version :9

Sequence 1:NP_611393.2 Gene:CG15116 / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_110453.3 Gene:Gpx1 / 24404 RGDID:2729 Length:201 Species:Rattus norvegicus


Alignment Length:185 Identity:61/185 - (32%)
Similarity:83/185 - (44%) Gaps:31/185 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 TIHALTVRD-TFGNPVQLDTFAGHVLLIVNIASKCGLTLSQYNGLRYLLEEYEDQGLRILNFPCN 102
            |::|.:.|. ..|.||.|.:..|.||||.|:||..|.|...|..:..|.:....:||.:|.||||
  Rat    13 TVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTTRDYTEMNDLQKRLGPRGLVVLGFPCN 77

  Fly   103 QFGGQMPESDGQEMLDHLR--REGANIG---HLFAKIDVKGAQADPLYKLLTRH----------- 151
            |||.| .....:|:|:.|:  |.|....   .||.|.:|.|.:|.||:..|...           
  Rat    78 QFGHQ-ENGKNEEILNSLKYVRPGGGFEPNFTLFEKCEVNGEKAHPLFTFLRNALPAPSDDPTAL 141

  Fly   152 -------------QHDIEWNFVKFLVDRKGNIHKRYGAELEPVALTDDIELLLGR 193
                         ::||.|||.||||...|...:||......:.:..|||.||.:
  Rat   142 MTDPKYIIWSPVCRNDISWNFEKFLVGPDGVPVRRYSRRFRTIDIEPDIEALLSK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15116NP_611393.2 GSH_Peroxidase 39..187 CDD:238207 56/177 (32%)
Gpx1NP_110453.3 GSH_Peroxidase 13..190 CDD:238207 56/177 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48732
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.