DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15116 and gpx-7

DIOPT Version :9

Sequence 1:NP_611393.2 Gene:CG15116 / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001123171.1 Gene:gpx-7 / 187542 WormBaseID:WBGene00019846 Length:197 Species:Caenorhabditis elegans


Alignment Length:162 Identity:61/162 - (37%)
Similarity:94/162 - (58%) Gaps:10/162 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 TIHALTVRDTFGNPVQLDTFAGHVLLIVNIASKCGLTLSQYNGLRYLLEEYEDQGLRILNFPCNQ 103
            ||:..:|||..|:.|.||.::|.|::|||:||.||||.|.|..|:.|.::|..:|||:..|||||
 Worm    32 TIYDFSVRDNSGDLVSLDKYSGLVVIIVNVASYCGLTNSNYKELKSLNDKYHLRGLRVAAFPCNQ 96

  Fly   104 FGGQMPESDGQEMLDHLRREGANIGHLFAKIDVKG----AQADPLYKLLTRHQ-----HDIEWNF 159
            ||.|.|..:. ::...:..:.:....|:.|:.|.|    .:.:||:..|.:.|     ..|:|||
 Worm    97 FGFQEPHCEA-DINKFVNEKFSFEPDLYGKVTVNGGPLIGEEEPLWTFLKKEQGGTLFDAIKWNF 160

  Fly   160 VKFLVDRKGNIHKRYGAELEPVALTDDIELLL 191
            .||||:|:|.:..|:|....|.:..::|..||
 Worm   161 TKFLVNRQGKVVARFGPSTNPKSFEEEIVKLL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15116NP_611393.2 GSH_Peroxidase 39..187 CDD:238207 58/156 (37%)
gpx-7NP_001123171.1 GSH_Peroxidase 32..188 CDD:238207 58/156 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 110 1.000 Domainoid score I3951
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48732
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 1 1.000 - - mtm4796
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X276
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.