DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15116 and gpx-5

DIOPT Version :9

Sequence 1:NP_611393.2 Gene:CG15116 / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_509615.3 Gene:gpx-5 / 181178 WormBaseID:WBGene00007516 Length:223 Species:Caenorhabditis elegans


Alignment Length:197 Identity:59/197 - (29%)
Similarity:86/197 - (43%) Gaps:47/197 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RW------RLTIHALTVRDTFGNPVQLDTFAGHVLLIVNIASKCGLTLSQYNGLRYLLEEYEDQG 93
            ||      ..:|:...|....|....|..:.|.|||:||:|:.|..| .||.....|:|:|:.||
 Worm    29 RWSQCKDTNQSIYDFQVETLQGEYTDLSQYRGQVLLMVNVATFCAYT-QQYTDFNPLIEKYQSQG 92

  Fly    94 LRILNFPCNQFGGQMPESDGQEMLDHLR--REG------ANIGHLFAKIDVKGAQADPLYKLLTR 150
            ..::.||||||..|.| ::..|:::.:.  |.|      .|: |::.|:|..|....|:|:.:..
 Worm    93 FTLIAFPCNQFYLQEP-AENHELMNGIMYVRPGNGWKPHQNL-HIYGKLDTNGDNQHPIYEFVKE 155

  Fly   151 --------------------HQHDIEWNFVKFLVDRKGNIHKRYGAELEPVA------LTDDIEL 189
                                ...||.|||.|||:||.|....|:    .|.|      :|..||.
 Worm   156 SCPQTVDKIGKTDELMYNPIRASDITWNFEKFLIDRNGQPRFRF----HPTAWSHGDVVTPFIEQ 216

  Fly   190 LL 191
            ||
 Worm   217 LL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15116NP_611393.2 GSH_Peroxidase 39..187 CDD:238207 53/181 (29%)
gpx-5NP_509615.3 GSH_Peroxidase 39..203 CDD:238207 51/170 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158322
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.