DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15116 and Gpx5

DIOPT Version :9

Sequence 1:NP_611393.2 Gene:CG15116 / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_034473.2 Gene:Gpx5 / 14780 MGIID:104886 Length:221 Species:Mus musculus


Alignment Length:187 Identity:66/187 - (35%)
Similarity:86/187 - (45%) Gaps:34/187 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVAVALVVVLQTRSR---LQQD-LQDMRWRLTIHALTVRDTFGNP-VQLDTFAGHVLLIVNIASK 71
            ||.:.|...:||..|   ::.| .:|::.  ||:........|.. :....:||..:|.||:|:.
Mouse    10 LVPLLLASYVQTTPRPEKMKMDCYKDVKG--TIYDYEALSLNGKEHIPFKQYAGKHVLFVNVATY 72

  Fly    72 CGLTLSQYNGLRYLLEEYEDQGLRILNFPCNQFGGQMPESDGQEMLDHLR--REGANI---GHLF 131
            ||||: ||..|..|.|:.:..||.||.|||||||.|.| .|..|:|..|:  |.|...   ..||
Mouse    73 CGLTI-QYPELNALQEDLKPFGLVILGFPCNQFGKQEP-GDNLEILPGLKYVRPGKGFLPNFQLF 135

  Fly   132 AKIDVKGAQADPLYKLLTR-------------HQ-------HDIEWNFVKFLVDRKG 168
            ||.||.|.....::..|.|             |.       |||.|||.||||...|
Mouse   136 AKGDVNGENEQKIFTFLKRSCPHPSETVVMSKHTFWEPIKVHDIRWNFEKFLVGPDG 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15116NP_611393.2 GSH_Peroxidase 39..187 CDD:238207 58/156 (37%)
Gpx5NP_034473.2 GSH_Peroxidase 39..211 CDD:238207 58/156 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.