DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15116 and Gpx1

DIOPT Version :9

Sequence 1:NP_611393.2 Gene:CG15116 / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_032186.2 Gene:Gpx1 / 14775 MGIID:104887 Length:201 Species:Mus musculus


Alignment Length:185 Identity:62/185 - (33%)
Similarity:85/185 - (45%) Gaps:31/185 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 TIHALTVRD-TFGNPVQLDTFAGHVLLIVNIASKCGLTLSQYNGLRYLLEEYEDQGLRILNFPCN 102
            |::|.:.|. |.|.||.|.:..|.||||.|:||..|.|:..|..:..|.:....:||.:|.||||
Mouse    13 TVYAFSARPLTGGEPVSLGSLRGKVLLIENVASLUGTTIRDYTEMNDLQKRLGPRGLVVLGFPCN 77

  Fly   103 QFGGQMPESDGQEMLDHLR--REGANIG---HLFAKIDVKGAQADPLYKLLTRH----------- 151
            |||.| .....:|:|:.|:  |.|....   .||.|.:|.|.:|.||:..|...           
Mouse    78 QFGHQ-ENGKNEEILNSLKYVRPGGGFEPNFTLFEKCEVNGEKAHPLFTFLRNALPTPSDDPTAL 141

  Fly   152 -------------QHDIEWNFVKFLVDRKGNIHKRYGAELEPVALTDDIELLLGR 193
                         ::||.|||.||||...|...:||......:.:..|||.||.:
Mouse   142 MTDPKYIIWSPVCRNDIAWNFEKFLVGPDGVPVRRYSRRFRTIDIEPDIETLLSQ 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15116NP_611393.2 GSH_Peroxidase 39..187 CDD:238207 57/177 (32%)
Gpx1NP_032186.2 GSH_Peroxidase 13..190 CDD:238207 57/177 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48732
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.