DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpxl and LOC11175968

DIOPT Version :10

Sequence 1:NP_611393.2 Gene:Gpxl / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:XP_061502144.1 Gene:LOC11175968 / 11175968 VectorBaseID:AGAMI1_007691 Length:684 Species:Anopheles gambiae


Alignment Length:102 Identity:28/102 - (27%)
Similarity:41/102 - (40%) Gaps:27/102 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 GSANGN-GPCGRSIDGATILTSLGNGH-----------GTSLYRAGPLFDRMPDELMVRIFEWLD 486
            |.|..| ||...|.||.:  ||.|..|           ..|.:....|....||::         
Mosquito    29 GQAGSNAGPASPSRDGPS--TSAGLPHTPSNRFAKDSTEPSPFSESSLAKMSPDKM--------- 82

  Fly   487 SSELCN-IARVCRRFESVIWNPALWKIIKIKGEENSG 522
            :..||| |.|:.:|.:..|.:.||   .:::..|:||
Mosquito    83 AESLCNEIKRLHKRKQLPITSSAL---ERMQDSESSG 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GpxlNP_611393.2 GSH_Peroxidase 39..187 CDD:238207
LOC11175968XP_061502144.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.