DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15116 and gpx2

DIOPT Version :9

Sequence 1:NP_611393.2 Gene:CG15116 / 37194 FlyBaseID:FBgn0034415 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001243244.1 Gene:gpx2 / 100145152 XenbaseID:XB-GENE-989081 Length:190 Species:Xenopus tropicalis


Alignment Length:171 Identity:57/171 - (33%)
Similarity:78/171 - (45%) Gaps:31/171 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GNPVQLDTFAGHVLLIVNIASKCGLTLSQYNGLRYLLEEYEDQGLRILNFPCNQFGGQMPESDGQ 114
            |..|..:.|.|.|:||.|:||. ..|:..|..|..|..:| .:.|.:|.|||||||.| .....:
 Frog    18 GEKVDFNVFRGRVVLIENVASLUDTTVRDYTQLNELQTKY-PRRLVVLGFPCNQFGYQ-ENCKNE 80

  Fly   115 EMLDHLR--REGANI--GH-LFAKIDVKGAQ-----------------------ADPLYKLLTR- 150
            |:|:.|:  |.|...  |. ||.|.||.|..                       :||.|.:... 
 Frog    81 EILNSLKYVRPGKGFVPGFTLFQKCDVNGKDTHSVFAYLKDKLPVPDNEPAALISDPRYIVWNPV 145

  Fly   151 HQHDIEWNFVKFLVDRKGNIHKRYGAELEPVALTDDIELLL 191
            |:.||.|||.|||:..:|...|||....:.:::..||:.||
 Frog   146 HRSDISWNFEKFLIGPEGEPFKRYNKNFQTISIEPDIQRLL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15116NP_611393.2 GSH_Peroxidase 39..187 CDD:238207 53/165 (32%)
gpx2NP_001243244.1 GSH_Peroxidase 7..182 CDD:238207 53/165 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.