DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 5-HT1B and or92a7

DIOPT Version :9

Sequence 1:NP_001137708.2 Gene:5-HT1B / 37191 FlyBaseID:FBgn0263116 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001373206.1 Gene:or92a7 / 794363 ZFINID:ZDB-GENE-070806-21 Length:322 Species:Danio rerio


Alignment Length:293 Identity:60/293 - (20%)
Similarity:100/293 - (34%) Gaps:111/293 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 NGNGNSNTF----------DLVDDEQERAAV---EFWLLVKMIAMAVVLGLMIL-----VTIIGN 108
            ||....::|          |||...:...||   .|:..|..:....:....|.     ..:.|:
Zfish     5 NGTAEDSSFTYQQIFKLDMDLVTSTKTAVAVLTSLFFFFVNCVMFFALKSKHIFFETPRYILFGH 69

  Fly   109 VFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISNGWILGPELCDIWTSCDVLC 173
            :.:..:::|   |.....|:||         .|. :|:             |:     :.|.:|.
Zfish    70 MLMNDSVLL---LVTTVMYVVA---------LCF-LPI-------------PK-----SICTLLV 103

  Fly   174 ----CT--ASILHLVAIAADRYWTVT-NIDYNNLRTPRRVFLMIFCVWFAA---------LIVSL 222
                ||  .:.|.|..::.:||..|. .:.:..:.||:|..:.|..:||.:         |.:.|
Zfish   104 FISHCTFRNAPLTLALMSLERYVAVCFPLRHCTIATPKRTGIGIGIIWFLSTINIITDIILALIL 168

  Fly   223 APQFGWKDPDYMKRIEEQHCMVSQ--------------DVGYQIFATCCTFYVPLLVILFLYWKI 273
            .|.|.    |::      .|.:.:              ||.|  ||:..      |:|:|.|..|
Zfish   169 NPNFA----DFI------FCTLEKLFVFKWQIDKNQWFDVIY--FASVA------LIIIFTYIMI 215

  Fly   274 YIIARKRIQRRAQKSFNVTLTETDCDSAVRELK 306
            .|.||.              ..:|.|||.:.||
Zfish   216 MITARS--------------VSSDKDSAKKALK 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
5-HT1BNP_001137708.2 7tm_1 107..>288 CDD:278431 43/210 (20%)
or92a7NP_001373206.1 7tm_1 61..293 CDD:394960 49/237 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.